Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1EB48

Protein Details
Accession A0A2V1EB48   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
111-133QHTRKHPSTCRACKKKITKAFDPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002219  PE/DAG-bd  
IPR011011  Znf_FYVE_PHD  
IPR013083  Znf_RING/FYVE/PHD  
Pfam View protein in Pfam  
PF00130  C1_1  
CDD cd00029  C1  
Amino Acid Sequences MLTMSYRVLDAVRSIPTTTNQILQVMTTHNEHQKARSQSTIERRNEGSIFRSATAPISPPPLTRPRKKSTPNSLSNASSSMCELPNNMRATASEYPQQRLGHEIAQVGIIQHTRKHPSTCRACKKKITKAFDPLVPCRICGRPYHESCLRSMGAVNSTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.2
4 0.25
5 0.24
6 0.25
7 0.23
8 0.23
9 0.22
10 0.2
11 0.19
12 0.16
13 0.17
14 0.16
15 0.19
16 0.22
17 0.27
18 0.27
19 0.29
20 0.35
21 0.39
22 0.4
23 0.4
24 0.39
25 0.42
26 0.51
27 0.58
28 0.52
29 0.5
30 0.48
31 0.47
32 0.45
33 0.39
34 0.32
35 0.26
36 0.25
37 0.22
38 0.21
39 0.18
40 0.18
41 0.17
42 0.15
43 0.12
44 0.15
45 0.15
46 0.14
47 0.19
48 0.28
49 0.34
50 0.41
51 0.48
52 0.5
53 0.58
54 0.66
55 0.71
56 0.72
57 0.74
58 0.73
59 0.69
60 0.66
61 0.58
62 0.5
63 0.42
64 0.31
65 0.22
66 0.16
67 0.13
68 0.09
69 0.08
70 0.09
71 0.1
72 0.15
73 0.17
74 0.16
75 0.15
76 0.15
77 0.21
78 0.22
79 0.21
80 0.2
81 0.2
82 0.22
83 0.27
84 0.27
85 0.21
86 0.23
87 0.23
88 0.2
89 0.19
90 0.18
91 0.13
92 0.13
93 0.13
94 0.1
95 0.09
96 0.09
97 0.09
98 0.11
99 0.15
100 0.21
101 0.24
102 0.29
103 0.34
104 0.43
105 0.53
106 0.61
107 0.68
108 0.72
109 0.75
110 0.8
111 0.83
112 0.84
113 0.83
114 0.8
115 0.76
116 0.76
117 0.75
118 0.7
119 0.66
120 0.59
121 0.58
122 0.5
123 0.44
124 0.39
125 0.38
126 0.35
127 0.34
128 0.38
129 0.4
130 0.44
131 0.51
132 0.54
133 0.51
134 0.51
135 0.52
136 0.44
137 0.34
138 0.32
139 0.27