Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DNI6

Protein Details
Accession A0A2V1DNI6    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
220-269GEKEEPTPKKLKKNDENPEPKPKSRGRPKAGEKKEPAKKKEPKKAATADGBasic
NLS Segment(s)
PositionSequence
220-279GEKEEPTPKKLKKNDENPEPKPKSRGRPKAGEKKEPAKKKEPKKAATADGQPRRSARNRS
Subcellular Location(s) nucl 17, cyto_nucl 12, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021331  Hva1_TUDOR  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MTVSWKWGGGRPGGEVAEVKEQGEIAIESNRGNTIKKNADPENPAVHIERPGNDVVKRASELEVEEKANGTNGDAKKEESAEKPDDKNEEKNGTNGDSKKEEESAEKADDKTEENPAESEQNSEDKPVETSDKDEEMKDAPTEKEAEPEKETQVDEKKDDAEAQNGVSKDEEESKEEESKEEDPKEEEPKDEDEKAETQDTEEPVTGDKRKAEEGPAANGEKEEPTPKKLKKNDENPEPKPKSRGRPKAGEKKEPAKKKEPKKAATADGQPRRSARNRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.23
4 0.26
5 0.25
6 0.22
7 0.18
8 0.18
9 0.17
10 0.17
11 0.15
12 0.09
13 0.12
14 0.12
15 0.12
16 0.13
17 0.16
18 0.16
19 0.17
20 0.2
21 0.25
22 0.32
23 0.36
24 0.42
25 0.44
26 0.5
27 0.53
28 0.53
29 0.5
30 0.44
31 0.42
32 0.37
33 0.33
34 0.31
35 0.29
36 0.25
37 0.23
38 0.24
39 0.25
40 0.24
41 0.26
42 0.23
43 0.24
44 0.23
45 0.22
46 0.2
47 0.18
48 0.2
49 0.2
50 0.21
51 0.19
52 0.18
53 0.17
54 0.16
55 0.16
56 0.14
57 0.11
58 0.16
59 0.16
60 0.2
61 0.2
62 0.21
63 0.21
64 0.23
65 0.26
66 0.21
67 0.26
68 0.28
69 0.32
70 0.33
71 0.34
72 0.38
73 0.38
74 0.4
75 0.4
76 0.4
77 0.35
78 0.36
79 0.35
80 0.32
81 0.34
82 0.31
83 0.29
84 0.26
85 0.27
86 0.26
87 0.26
88 0.24
89 0.2
90 0.22
91 0.21
92 0.21
93 0.22
94 0.2
95 0.2
96 0.2
97 0.19
98 0.18
99 0.19
100 0.17
101 0.16
102 0.16
103 0.16
104 0.18
105 0.16
106 0.15
107 0.11
108 0.13
109 0.13
110 0.13
111 0.13
112 0.11
113 0.11
114 0.11
115 0.13
116 0.11
117 0.13
118 0.14
119 0.16
120 0.16
121 0.16
122 0.15
123 0.14
124 0.14
125 0.12
126 0.12
127 0.1
128 0.1
129 0.13
130 0.12
131 0.16
132 0.17
133 0.19
134 0.2
135 0.21
136 0.21
137 0.2
138 0.2
139 0.19
140 0.23
141 0.22
142 0.21
143 0.21
144 0.21
145 0.19
146 0.21
147 0.18
148 0.14
149 0.13
150 0.12
151 0.15
152 0.14
153 0.14
154 0.12
155 0.11
156 0.11
157 0.15
158 0.15
159 0.14
160 0.16
161 0.18
162 0.22
163 0.22
164 0.21
165 0.19
166 0.21
167 0.24
168 0.24
169 0.22
170 0.21
171 0.24
172 0.3
173 0.28
174 0.26
175 0.24
176 0.28
177 0.31
178 0.29
179 0.26
180 0.23
181 0.24
182 0.25
183 0.24
184 0.19
185 0.17
186 0.2
187 0.2
188 0.19
189 0.17
190 0.15
191 0.15
192 0.19
193 0.2
194 0.18
195 0.2
196 0.21
197 0.23
198 0.25
199 0.26
200 0.29
201 0.29
202 0.31
203 0.33
204 0.32
205 0.3
206 0.28
207 0.26
208 0.2
209 0.2
210 0.23
211 0.21
212 0.25
213 0.35
214 0.41
215 0.5
216 0.56
217 0.65
218 0.68
219 0.76
220 0.81
221 0.82
222 0.86
223 0.83
224 0.87
225 0.83
226 0.76
227 0.74
228 0.72
229 0.72
230 0.73
231 0.77
232 0.74
233 0.78
234 0.85
235 0.87
236 0.88
237 0.88
238 0.85
239 0.84
240 0.86
241 0.85
242 0.82
243 0.82
244 0.83
245 0.84
246 0.86
247 0.86
248 0.82
249 0.82
250 0.81
251 0.78
252 0.76
253 0.75
254 0.75
255 0.74
256 0.71
257 0.66
258 0.62
259 0.63