Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1E803

Protein Details
Accession A0A2V1E803   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-53MREPVTSSRKNRHWNQTHRTRSISSQTHHQNFLPKKKHRHHHHTTDYEEHydrophilic
86-131QPPPCPSRYSKYQKPRRPQAQKEQQLGPLRCPRCRTRHRPTVQEERHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MVTAMREPVTSSRKNRHWNQTHRTRSISSQTHHQNFLPKKKHRHHHHTTDYEEIPGRWVRHQLQFRRDQRRRQQGERWQPQQQEEQPPPCPSRYSKYQKPRRPQAQKEQQLGPLRCPRCRTRHRPTVQEER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.72
3 0.75
4 0.79
5 0.82
6 0.85
7 0.86
8 0.86
9 0.82
10 0.77
11 0.68
12 0.63
13 0.62
14 0.58
15 0.5
16 0.5
17 0.55
18 0.54
19 0.54
20 0.5
21 0.5
22 0.51
23 0.59
24 0.59
25 0.57
26 0.64
27 0.7
28 0.79
29 0.8
30 0.83
31 0.82
32 0.83
33 0.85
34 0.81
35 0.75
36 0.7
37 0.6
38 0.52
39 0.43
40 0.32
41 0.25
42 0.22
43 0.19
44 0.15
45 0.19
46 0.21
47 0.28
48 0.35
49 0.38
50 0.42
51 0.51
52 0.58
53 0.65
54 0.67
55 0.69
56 0.72
57 0.77
58 0.76
59 0.73
60 0.74
61 0.73
62 0.79
63 0.78
64 0.73
65 0.69
66 0.64
67 0.61
68 0.59
69 0.54
70 0.52
71 0.48
72 0.47
73 0.45
74 0.47
75 0.46
76 0.4
77 0.38
78 0.32
79 0.33
80 0.39
81 0.45
82 0.51
83 0.6
84 0.69
85 0.75
86 0.83
87 0.87
88 0.88
89 0.89
90 0.89
91 0.89
92 0.9
93 0.9
94 0.85
95 0.78
96 0.74
97 0.73
98 0.66
99 0.62
100 0.61
101 0.56
102 0.55
103 0.57
104 0.58
105 0.59
106 0.68
107 0.7
108 0.72
109 0.78
110 0.82
111 0.85