Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1DJ13

Protein Details
Accession A0A2V1DJ13    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
69-93CFYPNKKTQTNKKKKPPPGTFPRINHydrophilic
NLS Segment(s)
PositionSequence
80-84KKKKP
Subcellular Location(s) mito 13.5, nucl 12.5, cyto_mito 7.833, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MNCARAVLHPLSPSHPILSSSKLTARFFRPLPHCPPSSSPPHPSSPLLYPIPSHPVSLFPPKSKFVRGCFYPNKKTQTNKKKKPPPGTFPRINPQNITTQILIKHPPLLLPSPRPPFPLPSLPPHSFPSHTRKKVLSPSYPPRKFPPRPMSVFNLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.24
4 0.24
5 0.27
6 0.26
7 0.25
8 0.28
9 0.32
10 0.33
11 0.36
12 0.38
13 0.39
14 0.38
15 0.44
16 0.45
17 0.46
18 0.51
19 0.52
20 0.5
21 0.47
22 0.51
23 0.47
24 0.5
25 0.49
26 0.48
27 0.45
28 0.48
29 0.47
30 0.44
31 0.42
32 0.36
33 0.36
34 0.31
35 0.27
36 0.24
37 0.22
38 0.27
39 0.24
40 0.21
41 0.16
42 0.17
43 0.2
44 0.28
45 0.29
46 0.27
47 0.3
48 0.32
49 0.34
50 0.37
51 0.38
52 0.33
53 0.37
54 0.36
55 0.41
56 0.47
57 0.53
58 0.54
59 0.56
60 0.58
61 0.56
62 0.6
63 0.63
64 0.65
65 0.69
66 0.71
67 0.76
68 0.8
69 0.84
70 0.88
71 0.85
72 0.84
73 0.83
74 0.81
75 0.76
76 0.71
77 0.71
78 0.66
79 0.59
80 0.51
81 0.42
82 0.4
83 0.36
84 0.35
85 0.27
86 0.23
87 0.23
88 0.24
89 0.24
90 0.18
91 0.19
92 0.16
93 0.16
94 0.16
95 0.2
96 0.21
97 0.25
98 0.33
99 0.36
100 0.37
101 0.41
102 0.4
103 0.4
104 0.41
105 0.44
106 0.4
107 0.43
108 0.49
109 0.47
110 0.49
111 0.48
112 0.46
113 0.4
114 0.42
115 0.44
116 0.47
117 0.5
118 0.52
119 0.51
120 0.55
121 0.62
122 0.65
123 0.63
124 0.62
125 0.68
126 0.75
127 0.77
128 0.73
129 0.72
130 0.75
131 0.73
132 0.74
133 0.73
134 0.72
135 0.73
136 0.75