Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2UJM8

Protein Details
Accession Q2UJM8    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
117-136PKPAEKPRRKLRARKAAMKLBasic
NLS Segment(s)
PositionSequence
116-133APKPAEKPRRKLRARKAA
Subcellular Location(s) mito 22.5, mito_nucl 13.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000361  FeS_biogenesis  
IPR016092  FeS_cluster_insertion  
IPR017870  FeS_cluster_insertion_CS  
IPR035903  HesB-like_dom_sf  
Gene Ontology GO:0051536  F:iron-sulfur cluster binding  
GO:0016226  P:iron-sulfur cluster assembly  
KEGG aor:AO090003001146  -  
Pfam View protein in Pfam  
PF01521  Fe-S_biosyn  
PROSITE View protein in PROSITE  
PS01152  HESB  
Amino Acid Sequences MSFSRVTVRSPVTSSATMLRCVRSPYKTPAHRLFSSYGNAHRSSKRDMQTATAYRPHSLPTAFPPPRSGGSYDTSISADFPPLRETATQQQGIFPNVSLRENEAQKSKPVESTSPAPKPAEKPRRKLRARKAAMKLTPEAIVQLRKLLSQPDPKLIRVGVKNRGCSGLAYHLEYVEKPGTFDEVVEQDGVKVLIDSKALFSIIGSEMDWQEDKLSRRFIFKNPNIKESCGCGESFMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.32
4 0.34
5 0.33
6 0.31
7 0.29
8 0.34
9 0.38
10 0.36
11 0.4
12 0.44
13 0.52
14 0.57
15 0.63
16 0.67
17 0.68
18 0.64
19 0.62
20 0.56
21 0.5
22 0.48
23 0.43
24 0.39
25 0.36
26 0.37
27 0.38
28 0.4
29 0.4
30 0.41
31 0.46
32 0.45
33 0.46
34 0.45
35 0.45
36 0.49
37 0.5
38 0.47
39 0.45
40 0.42
41 0.38
42 0.37
43 0.34
44 0.28
45 0.24
46 0.21
47 0.21
48 0.3
49 0.31
50 0.31
51 0.32
52 0.32
53 0.34
54 0.34
55 0.3
56 0.23
57 0.24
58 0.26
59 0.24
60 0.22
61 0.2
62 0.17
63 0.16
64 0.13
65 0.13
66 0.11
67 0.11
68 0.12
69 0.11
70 0.12
71 0.12
72 0.15
73 0.2
74 0.25
75 0.27
76 0.25
77 0.28
78 0.29
79 0.3
80 0.26
81 0.19
82 0.16
83 0.15
84 0.16
85 0.12
86 0.14
87 0.17
88 0.18
89 0.2
90 0.21
91 0.21
92 0.23
93 0.26
94 0.23
95 0.22
96 0.22
97 0.22
98 0.21
99 0.26
100 0.3
101 0.29
102 0.3
103 0.28
104 0.28
105 0.32
106 0.39
107 0.45
108 0.44
109 0.51
110 0.59
111 0.69
112 0.75
113 0.79
114 0.79
115 0.79
116 0.8
117 0.8
118 0.78
119 0.75
120 0.71
121 0.64
122 0.55
123 0.45
124 0.39
125 0.29
126 0.23
127 0.17
128 0.16
129 0.12
130 0.14
131 0.12
132 0.12
133 0.13
134 0.14
135 0.18
136 0.25
137 0.27
138 0.33
139 0.35
140 0.35
141 0.36
142 0.34
143 0.34
144 0.32
145 0.36
146 0.37
147 0.39
148 0.41
149 0.4
150 0.42
151 0.37
152 0.31
153 0.28
154 0.26
155 0.23
156 0.23
157 0.22
158 0.21
159 0.21
160 0.2
161 0.21
162 0.16
163 0.14
164 0.12
165 0.13
166 0.14
167 0.14
168 0.14
169 0.13
170 0.11
171 0.12
172 0.12
173 0.12
174 0.09
175 0.1
176 0.1
177 0.07
178 0.06
179 0.06
180 0.07
181 0.08
182 0.09
183 0.09
184 0.1
185 0.1
186 0.1
187 0.08
188 0.1
189 0.1
190 0.11
191 0.1
192 0.11
193 0.11
194 0.14
195 0.14
196 0.12
197 0.13
198 0.18
199 0.21
200 0.24
201 0.32
202 0.31
203 0.38
204 0.41
205 0.47
206 0.53
207 0.58
208 0.64
209 0.61
210 0.69
211 0.65
212 0.65
213 0.6
214 0.54
215 0.51
216 0.42
217 0.37