Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DJN0

Protein Details
Accession A0A2V1DJN0   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
5-30RSLNTSLPKTRRRQPTPQPDTHQSFRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029196  HAPSTR1-like  
Pfam View protein in Pfam  
PF15251  DUF4588  
Amino Acid Sequences MDSMRSLNTSLPKTRRRQPTPQPDTHQSFRSAALTVTNLYKAALADIDRSRSDGYQDALEDLIGFLDKENLGISDGEGWRIRQWATERLDGSLPVQSTSESDDEDDKRARSSSPIMERNSSPEETRTVEPAHRSDSATPPVAAELPTDADMTPLPTMFHFSSPQAYPSSAPSDGTSYDLPAAARRAFPPPRRTTHRSSSRNLRQSAAQNIVNIASGTGTGQKRKIMHDFFNIDMNDRRDGPGGGPKRGRMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.73
3 0.74
4 0.79
5 0.81
6 0.84
7 0.84
8 0.86
9 0.85
10 0.83
11 0.83
12 0.77
13 0.7
14 0.62
15 0.54
16 0.46
17 0.4
18 0.31
19 0.24
20 0.21
21 0.19
22 0.17
23 0.17
24 0.16
25 0.14
26 0.13
27 0.14
28 0.11
29 0.11
30 0.11
31 0.1
32 0.14
33 0.16
34 0.19
35 0.19
36 0.2
37 0.21
38 0.2
39 0.21
40 0.19
41 0.18
42 0.17
43 0.17
44 0.16
45 0.15
46 0.14
47 0.12
48 0.09
49 0.07
50 0.05
51 0.05
52 0.04
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.07
59 0.07
60 0.08
61 0.11
62 0.11
63 0.13
64 0.14
65 0.14
66 0.14
67 0.16
68 0.16
69 0.15
70 0.18
71 0.24
72 0.27
73 0.31
74 0.3
75 0.3
76 0.31
77 0.27
78 0.24
79 0.19
80 0.15
81 0.11
82 0.11
83 0.09
84 0.09
85 0.11
86 0.11
87 0.09
88 0.09
89 0.12
90 0.13
91 0.16
92 0.18
93 0.16
94 0.16
95 0.16
96 0.16
97 0.14
98 0.17
99 0.2
100 0.26
101 0.32
102 0.33
103 0.35
104 0.34
105 0.36
106 0.36
107 0.31
108 0.23
109 0.18
110 0.19
111 0.19
112 0.2
113 0.18
114 0.16
115 0.16
116 0.18
117 0.18
118 0.19
119 0.18
120 0.18
121 0.18
122 0.21
123 0.22
124 0.21
125 0.2
126 0.17
127 0.16
128 0.15
129 0.13
130 0.09
131 0.07
132 0.06
133 0.07
134 0.07
135 0.07
136 0.07
137 0.07
138 0.08
139 0.08
140 0.07
141 0.06
142 0.06
143 0.1
144 0.1
145 0.12
146 0.12
147 0.13
148 0.16
149 0.17
150 0.19
151 0.16
152 0.16
153 0.15
154 0.16
155 0.2
156 0.16
157 0.16
158 0.15
159 0.16
160 0.16
161 0.18
162 0.15
163 0.12
164 0.12
165 0.12
166 0.11
167 0.12
168 0.14
169 0.13
170 0.14
171 0.15
172 0.22
173 0.29
174 0.37
175 0.45
176 0.49
177 0.56
178 0.63
179 0.68
180 0.68
181 0.71
182 0.74
183 0.71
184 0.71
185 0.74
186 0.76
187 0.78
188 0.72
189 0.63
190 0.58
191 0.58
192 0.58
193 0.53
194 0.44
195 0.36
196 0.35
197 0.33
198 0.28
199 0.22
200 0.15
201 0.09
202 0.07
203 0.07
204 0.13
205 0.16
206 0.19
207 0.22
208 0.27
209 0.29
210 0.35
211 0.43
212 0.42
213 0.45
214 0.5
215 0.52
216 0.48
217 0.53
218 0.47
219 0.42
220 0.42
221 0.39
222 0.33
223 0.3
224 0.31
225 0.26
226 0.27
227 0.26
228 0.3
229 0.33
230 0.38
231 0.42