Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DAP6

Protein Details
Accession A0A2V1DAP6    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-42SKFHVLKRTARAKNKHLSKNKKMYKRYSGGHydrophilic
NLS Segment(s)
PositionSequence
20-34RTARAKNKHLSKNKK
Subcellular Location(s) mito 20, mito_nucl 13.833, cyto_mito 10.833, nucl 6.5
Family & Domain DBs
Amino Acid Sequences MITMGSVRIFTLSKFHVLKRTARAKNKHLSKNKKMYKRYSGGYLYMFSKRACKNGETKHVFTVLRAILQRHDFFSTPLRENNPLNSDLQSPSSHSEDHGQSQSGDVGLGHGASVGGGGGGRGGSGGTGAGARARGAAAGGAGRGRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.33
4 0.37
5 0.43
6 0.47
7 0.56
8 0.58
9 0.65
10 0.7
11 0.71
12 0.77
13 0.81
14 0.81
15 0.81
16 0.83
17 0.83
18 0.86
19 0.87
20 0.87
21 0.85
22 0.84
23 0.83
24 0.78
25 0.71
26 0.67
27 0.6
28 0.53
29 0.46
30 0.39
31 0.32
32 0.29
33 0.27
34 0.21
35 0.25
36 0.24
37 0.28
38 0.28
39 0.28
40 0.34
41 0.4
42 0.5
43 0.49
44 0.49
45 0.46
46 0.48
47 0.45
48 0.36
49 0.33
50 0.23
51 0.19
52 0.18
53 0.17
54 0.16
55 0.19
56 0.2
57 0.16
58 0.18
59 0.15
60 0.16
61 0.2
62 0.22
63 0.2
64 0.22
65 0.23
66 0.24
67 0.25
68 0.27
69 0.25
70 0.22
71 0.21
72 0.2
73 0.19
74 0.17
75 0.19
76 0.16
77 0.15
78 0.16
79 0.17
80 0.16
81 0.15
82 0.19
83 0.18
84 0.22
85 0.21
86 0.19
87 0.18
88 0.18
89 0.18
90 0.13
91 0.11
92 0.07
93 0.06
94 0.06
95 0.05
96 0.04
97 0.04
98 0.04
99 0.03
100 0.03
101 0.03
102 0.02
103 0.02
104 0.02
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.04
115 0.04
116 0.05
117 0.06
118 0.06
119 0.07
120 0.07
121 0.07
122 0.07
123 0.07
124 0.07
125 0.07
126 0.08