Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DU10

Protein Details
Accession A0A2V1DU10   
Localization Confidence High
Confidence Score 22.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-28SPGPKPATSQPKQARSKKAATPHydrophilic
87-112NEAASASRPKRKPRKLNREPAPDKSTHydrophilic
153-176TSTGTRPGRSPRRRGKGRKGSSATHydrophilic
NLS Segment(s)
PositionSequence
93-105SRPKRKPRKLNRE
158-172RPGRSPRRRGKGRKG
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
Amino Acid Sequences MPSGSQSPGPKPATSQPKQARSKKAATPSQKIVIGRSGSAGGIVLENEQTRKKETSPKSAIDSKSVVNPATDNKMNTTAVKNDEKGNEAASASRPKRKPRKLNREPAPDKSTAPTPTTATTVNSTSSPAAAAELEALKSRVRGLEAKVEELYTSTGTRPGRSPRRRGKGRKGSSATQVPTLASTAAPTPVENEEELADEELTRLEDELEDARRDLMLHQPHTRPRTKRSTSEDTEYVEEIPREGGRTVTTGDRQVTLSGSYRIPLPATLSMDDVKSIQNGVSAAQNVAKSFLDQRRASQASRSSTQPAASKPAPKATSRKTSAPTAEVSRDSRDNNGKSWGEWFGGYSVAISKAMKNIEAEAAIESQRAAGASAPRPGKTSSAKKAASNIRPGMKAQQSNLSSEQVLGLMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.58
3 0.59
4 0.66
5 0.76
6 0.8
7 0.81
8 0.78
9 0.82
10 0.79
11 0.79
12 0.79
13 0.77
14 0.77
15 0.73
16 0.71
17 0.68
18 0.61
19 0.54
20 0.51
21 0.43
22 0.36
23 0.31
24 0.25
25 0.21
26 0.2
27 0.17
28 0.1
29 0.09
30 0.09
31 0.08
32 0.09
33 0.1
34 0.13
35 0.17
36 0.19
37 0.23
38 0.25
39 0.29
40 0.38
41 0.44
42 0.52
43 0.55
44 0.57
45 0.6
46 0.65
47 0.62
48 0.56
49 0.52
50 0.42
51 0.41
52 0.4
53 0.33
54 0.26
55 0.26
56 0.25
57 0.29
58 0.31
59 0.26
60 0.26
61 0.29
62 0.3
63 0.31
64 0.3
65 0.28
66 0.31
67 0.35
68 0.33
69 0.34
70 0.35
71 0.36
72 0.33
73 0.3
74 0.25
75 0.2
76 0.2
77 0.2
78 0.28
79 0.28
80 0.37
81 0.41
82 0.5
83 0.61
84 0.7
85 0.77
86 0.78
87 0.86
88 0.88
89 0.93
90 0.93
91 0.93
92 0.88
93 0.85
94 0.79
95 0.7
96 0.6
97 0.52
98 0.48
99 0.39
100 0.36
101 0.29
102 0.26
103 0.25
104 0.25
105 0.24
106 0.2
107 0.19
108 0.18
109 0.17
110 0.16
111 0.16
112 0.14
113 0.13
114 0.11
115 0.09
116 0.08
117 0.07
118 0.07
119 0.06
120 0.07
121 0.07
122 0.07
123 0.08
124 0.08
125 0.08
126 0.09
127 0.09
128 0.11
129 0.13
130 0.15
131 0.23
132 0.24
133 0.26
134 0.25
135 0.24
136 0.21
137 0.19
138 0.18
139 0.1
140 0.1
141 0.08
142 0.13
143 0.13
144 0.15
145 0.18
146 0.27
147 0.37
148 0.44
149 0.54
150 0.59
151 0.69
152 0.78
153 0.84
154 0.86
155 0.86
156 0.85
157 0.85
158 0.8
159 0.73
160 0.69
161 0.66
162 0.56
163 0.47
164 0.4
165 0.3
166 0.25
167 0.22
168 0.15
169 0.08
170 0.08
171 0.06
172 0.07
173 0.07
174 0.06
175 0.08
176 0.08
177 0.1
178 0.09
179 0.09
180 0.08
181 0.09
182 0.09
183 0.08
184 0.07
185 0.06
186 0.06
187 0.05
188 0.05
189 0.04
190 0.04
191 0.04
192 0.04
193 0.05
194 0.07
195 0.08
196 0.08
197 0.08
198 0.08
199 0.08
200 0.09
201 0.09
202 0.13
203 0.16
204 0.19
205 0.24
206 0.28
207 0.34
208 0.39
209 0.46
210 0.43
211 0.46
212 0.54
213 0.54
214 0.58
215 0.61
216 0.64
217 0.6
218 0.61
219 0.56
220 0.47
221 0.44
222 0.37
223 0.29
224 0.21
225 0.17
226 0.12
227 0.11
228 0.09
229 0.09
230 0.09
231 0.08
232 0.08
233 0.09
234 0.1
235 0.12
236 0.13
237 0.15
238 0.15
239 0.16
240 0.16
241 0.15
242 0.14
243 0.13
244 0.14
245 0.13
246 0.13
247 0.12
248 0.13
249 0.12
250 0.12
251 0.11
252 0.12
253 0.12
254 0.14
255 0.15
256 0.15
257 0.16
258 0.15
259 0.15
260 0.13
261 0.11
262 0.09
263 0.09
264 0.07
265 0.08
266 0.08
267 0.08
268 0.1
269 0.1
270 0.1
271 0.12
272 0.13
273 0.12
274 0.14
275 0.13
276 0.12
277 0.18
278 0.22
279 0.28
280 0.28
281 0.3
282 0.38
283 0.41
284 0.4
285 0.39
286 0.41
287 0.39
288 0.41
289 0.41
290 0.36
291 0.35
292 0.38
293 0.35
294 0.3
295 0.32
296 0.33
297 0.36
298 0.35
299 0.41
300 0.41
301 0.42
302 0.48
303 0.48
304 0.55
305 0.54
306 0.58
307 0.53
308 0.57
309 0.56
310 0.51
311 0.47
312 0.41
313 0.4
314 0.38
315 0.37
316 0.34
317 0.34
318 0.33
319 0.36
320 0.41
321 0.39
322 0.37
323 0.43
324 0.39
325 0.36
326 0.38
327 0.33
328 0.25
329 0.23
330 0.22
331 0.15
332 0.15
333 0.14
334 0.11
335 0.1
336 0.1
337 0.11
338 0.11
339 0.12
340 0.16
341 0.17
342 0.18
343 0.17
344 0.18
345 0.18
346 0.18
347 0.17
348 0.15
349 0.15
350 0.14
351 0.13
352 0.12
353 0.1
354 0.1
355 0.09
356 0.08
357 0.09
358 0.15
359 0.18
360 0.26
361 0.28
362 0.29
363 0.31
364 0.32
365 0.36
366 0.39
367 0.46
368 0.48
369 0.54
370 0.57
371 0.57
372 0.64
373 0.68
374 0.66
375 0.66
376 0.64
377 0.6
378 0.59
379 0.59
380 0.59
381 0.57
382 0.54
383 0.48
384 0.51
385 0.46
386 0.49
387 0.5
388 0.44
389 0.36
390 0.31
391 0.28