Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1DKJ6

Protein Details
Accession A0A2V1DKJ6    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
48-74PGRYHYHRIHRRPSRHHHHHNHSHLTYBasic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPHMRLSDTKIHQVPSHDLLLSLPGNTYYHPRSPPTNQPPASVWHPHPGRYHYHRIHRRPSRHHHHHNHSHLTYLFIPQPWRLPWILSHIVVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.38
3 0.37
4 0.28
5 0.25
6 0.23
7 0.24
8 0.2
9 0.15
10 0.11
11 0.1
12 0.1
13 0.11
14 0.15
15 0.15
16 0.19
17 0.21
18 0.24
19 0.28
20 0.33
21 0.43
22 0.46
23 0.52
24 0.48
25 0.48
26 0.47
27 0.46
28 0.45
29 0.38
30 0.32
31 0.31
32 0.31
33 0.32
34 0.33
35 0.31
36 0.34
37 0.36
38 0.45
39 0.42
40 0.52
41 0.58
42 0.62
43 0.7
44 0.73
45 0.75
46 0.75
47 0.8
48 0.8
49 0.82
50 0.86
51 0.85
52 0.86
53 0.88
54 0.86
55 0.85
56 0.74
57 0.68
58 0.57
59 0.51
60 0.42
61 0.35
62 0.29
63 0.23
64 0.24
65 0.22
66 0.27
67 0.24
68 0.26
69 0.24
70 0.23
71 0.23
72 0.29
73 0.32