Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q2UB34

Protein Details
Accession Q2UB34    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
125-149EEYGELKKKRREERIAIRKKEQRLYBasic
NLS Segment(s)
PositionSequence
63-86PDGAERKPERRPGRGGREEERKRG
131-144KKKRREERIAIRKK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006786  Pinin_SDK_MemA  
Pfam View protein in Pfam  
PF04696  Pinin_SDK_memA  
Amino Acid Sequences MSRTLASAVVLPEQDNLPPSPDAGLKRRNSVAEADSESKRRRLSSQQDHTGDRSPAERKQSSPDGAERKPERRPGRGGREEERKRGQRLFGALLGTLSQSSTSAAQKRRADIERRQQDKLKLQDEEYGELKKKRREERIAIRKKEQRLYEEESG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.15
5 0.15
6 0.15
7 0.15
8 0.18
9 0.22
10 0.27
11 0.35
12 0.34
13 0.39
14 0.42
15 0.42
16 0.39
17 0.38
18 0.33
19 0.29
20 0.31
21 0.3
22 0.3
23 0.34
24 0.35
25 0.35
26 0.36
27 0.33
28 0.33
29 0.39
30 0.47
31 0.52
32 0.59
33 0.64
34 0.65
35 0.65
36 0.63
37 0.58
38 0.48
39 0.38
40 0.32
41 0.26
42 0.26
43 0.31
44 0.3
45 0.27
46 0.33
47 0.37
48 0.35
49 0.34
50 0.37
51 0.36
52 0.35
53 0.42
54 0.4
55 0.39
56 0.41
57 0.48
58 0.46
59 0.44
60 0.51
61 0.52
62 0.58
63 0.61
64 0.61
65 0.58
66 0.64
67 0.63
68 0.61
69 0.61
70 0.56
71 0.52
72 0.5
73 0.46
74 0.38
75 0.38
76 0.34
77 0.27
78 0.23
79 0.19
80 0.17
81 0.15
82 0.12
83 0.09
84 0.06
85 0.05
86 0.04
87 0.05
88 0.07
89 0.11
90 0.17
91 0.22
92 0.3
93 0.32
94 0.35
95 0.41
96 0.45
97 0.48
98 0.51
99 0.58
100 0.6
101 0.63
102 0.65
103 0.63
104 0.64
105 0.66
106 0.65
107 0.6
108 0.52
109 0.49
110 0.5
111 0.47
112 0.44
113 0.37
114 0.34
115 0.33
116 0.36
117 0.41
118 0.42
119 0.48
120 0.54
121 0.62
122 0.66
123 0.72
124 0.78
125 0.83
126 0.87
127 0.85
128 0.86
129 0.83
130 0.82
131 0.79
132 0.74
133 0.69
134 0.65