Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1ECP7

Protein Details
Accession A0A2V1ECP7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
116-147WDKDWSKKEFREKAPPREKTKDRQGKKVSVGRBasic
NLS Segment(s)
PositionSequence
122-153KKEFREKAPPREKTKDRQGKKVSVGRSSSMRK
Subcellular Location(s) mito 16.5, mito_nucl 13.5, nucl 9.5
Family & Domain DBs
Amino Acid Sequences MTRNTLVTQNINTGLASSLGHHCTICSKPISTSCLKKLHVAFCKAPKNPARPEDGECGFRFNVRSPGGCCKHPYNMGFNEDVKAALKGGCARIDEVAEDEEGMECGGEEGGEDRPWDKDWSKKEFREKAPPREKTKDRQGKKVSVGRSSSMRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.12
4 0.11
5 0.14
6 0.15
7 0.16
8 0.15
9 0.14
10 0.18
11 0.2
12 0.21
13 0.2
14 0.2
15 0.22
16 0.27
17 0.32
18 0.34
19 0.39
20 0.42
21 0.46
22 0.46
23 0.49
24 0.5
25 0.53
26 0.54
27 0.53
28 0.51
29 0.53
30 0.6
31 0.55
32 0.58
33 0.56
34 0.56
35 0.57
36 0.55
37 0.53
38 0.48
39 0.51
40 0.49
41 0.44
42 0.41
43 0.34
44 0.34
45 0.27
46 0.25
47 0.23
48 0.18
49 0.22
50 0.2
51 0.21
52 0.21
53 0.3
54 0.32
55 0.32
56 0.34
57 0.3
58 0.32
59 0.35
60 0.34
61 0.3
62 0.3
63 0.3
64 0.28
65 0.26
66 0.23
67 0.19
68 0.17
69 0.12
70 0.1
71 0.08
72 0.06
73 0.07
74 0.08
75 0.09
76 0.11
77 0.11
78 0.11
79 0.11
80 0.11
81 0.11
82 0.1
83 0.09
84 0.08
85 0.07
86 0.06
87 0.06
88 0.06
89 0.05
90 0.04
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.04
97 0.06
98 0.06
99 0.07
100 0.07
101 0.09
102 0.12
103 0.16
104 0.17
105 0.23
106 0.3
107 0.39
108 0.47
109 0.53
110 0.61
111 0.66
112 0.7
113 0.75
114 0.77
115 0.79
116 0.81
117 0.83
118 0.81
119 0.82
120 0.82
121 0.81
122 0.83
123 0.82
124 0.78
125 0.8
126 0.8
127 0.78
128 0.81
129 0.78
130 0.73
131 0.7
132 0.67
133 0.6