Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1D0Z8

Protein Details
Accession A0A2V1D0Z8   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
141-167HKEGNAKTEHRQRRRTRYYSDKKAHHPBasic
NLS Segment(s)
PositionSequence
95-104RASRRKSQRA
Subcellular Location(s) nucl 16, cyto 8, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036869  J_dom_sf  
Amino Acid Sequences MADAIYSILEEVNIFGLLDLDPRKLRNHSVAYIVKELRTAYRKAALIAHPDKDPTKGLETIQYLNRLKDFLSNFDEHQVNPTRVTRLVERGCKGRASRRKSQRAWKSLRPQANALRAGSSPSNPIFLDVPEISAPHTRQEHKEGNAKTEHRQRRRTRYYSDKKAHHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.06
4 0.06
5 0.1
6 0.11
7 0.13
8 0.15
9 0.17
10 0.21
11 0.24
12 0.28
13 0.33
14 0.37
15 0.35
16 0.42
17 0.45
18 0.45
19 0.48
20 0.44
21 0.36
22 0.32
23 0.31
24 0.29
25 0.28
26 0.26
27 0.23
28 0.28
29 0.28
30 0.28
31 0.32
32 0.28
33 0.33
34 0.35
35 0.34
36 0.29
37 0.3
38 0.3
39 0.27
40 0.25
41 0.19
42 0.19
43 0.19
44 0.19
45 0.21
46 0.23
47 0.24
48 0.25
49 0.3
50 0.27
51 0.27
52 0.26
53 0.22
54 0.2
55 0.22
56 0.2
57 0.17
58 0.2
59 0.21
60 0.21
61 0.24
62 0.24
63 0.19
64 0.22
65 0.22
66 0.18
67 0.19
68 0.2
69 0.18
70 0.18
71 0.2
72 0.17
73 0.21
74 0.25
75 0.28
76 0.29
77 0.31
78 0.31
79 0.32
80 0.33
81 0.35
82 0.39
83 0.41
84 0.5
85 0.57
86 0.66
87 0.69
88 0.78
89 0.78
90 0.79
91 0.8
92 0.79
93 0.78
94 0.76
95 0.76
96 0.69
97 0.64
98 0.61
99 0.61
100 0.54
101 0.45
102 0.39
103 0.32
104 0.32
105 0.27
106 0.22
107 0.18
108 0.16
109 0.18
110 0.16
111 0.17
112 0.15
113 0.14
114 0.18
115 0.15
116 0.16
117 0.14
118 0.14
119 0.15
120 0.19
121 0.19
122 0.2
123 0.25
124 0.27
125 0.31
126 0.39
127 0.45
128 0.45
129 0.53
130 0.49
131 0.49
132 0.53
133 0.52
134 0.53
135 0.56
136 0.62
137 0.63
138 0.71
139 0.76
140 0.8
141 0.87
142 0.86
143 0.85
144 0.86
145 0.87
146 0.88
147 0.88