Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1EGM5

Protein Details
Accession A0A2V1EGM5    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
59-80RQSLKRQKGKAGKKWKCKQMVNHydrophilic
NLS Segment(s)
PositionSequence
63-72KRQKGKAGKK
Subcellular Location(s) mito 20, nucl 4.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MQLFQPWNKWPMGTFPFSASTPLTHRPRKKPTSFIIPLYPRSPYFLLLPGPLCFVLCLRQSLKRQKGKAGKKWKCKQMVNTGFWEEGNWTEGGGVGGNTSFTSFGCARDWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.31
4 0.3
5 0.31
6 0.24
7 0.21
8 0.22
9 0.29
10 0.35
11 0.41
12 0.49
13 0.57
14 0.66
15 0.74
16 0.75
17 0.74
18 0.72
19 0.74
20 0.69
21 0.63
22 0.61
23 0.55
24 0.52
25 0.46
26 0.42
27 0.31
28 0.31
29 0.28
30 0.21
31 0.18
32 0.18
33 0.17
34 0.16
35 0.17
36 0.14
37 0.14
38 0.12
39 0.11
40 0.08
41 0.08
42 0.09
43 0.09
44 0.11
45 0.12
46 0.18
47 0.25
48 0.35
49 0.44
50 0.48
51 0.49
52 0.56
53 0.64
54 0.68
55 0.71
56 0.73
57 0.73
58 0.77
59 0.84
60 0.84
61 0.83
62 0.79
63 0.77
64 0.77
65 0.77
66 0.7
67 0.65
68 0.59
69 0.5
70 0.44
71 0.37
72 0.26
73 0.18
74 0.16
75 0.12
76 0.09
77 0.08
78 0.09
79 0.09
80 0.08
81 0.07
82 0.05
83 0.05
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.11
90 0.12
91 0.14