Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1E7T3

Protein Details
Accession A0A2V1E7T3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
75-104DRCHPAGARLRIRKRQRKRSRDGNMLRFFGBasic
NLS Segment(s)
PositionSequence
82-95ARLRIRKRQRKRSR
Subcellular Location(s) mito 23, plas 2
Family & Domain DBs
Amino Acid Sequences MRAQRSAVQRATKHQGAPVRLPDTPPHRLAVASLPFLIVSYLWGGADPRFGCDCYMGCVQLCLPLWAMFSGPKADRCHPAGARLRIRKRQRKRSRDGNMLRFFGDVELGVGGFLRDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.49
3 0.46
4 0.49
5 0.48
6 0.44
7 0.41
8 0.41
9 0.43
10 0.43
11 0.43
12 0.39
13 0.33
14 0.3
15 0.29
16 0.28
17 0.28
18 0.25
19 0.2
20 0.18
21 0.17
22 0.16
23 0.16
24 0.15
25 0.08
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.06
32 0.06
33 0.1
34 0.09
35 0.11
36 0.12
37 0.12
38 0.12
39 0.13
40 0.13
41 0.13
42 0.14
43 0.11
44 0.1
45 0.1
46 0.1
47 0.12
48 0.12
49 0.09
50 0.09
51 0.09
52 0.09
53 0.09
54 0.1
55 0.07
56 0.08
57 0.11
58 0.11
59 0.15
60 0.19
61 0.22
62 0.26
63 0.28
64 0.34
65 0.31
66 0.38
67 0.42
68 0.46
69 0.53
70 0.58
71 0.63
72 0.67
73 0.77
74 0.79
75 0.82
76 0.85
77 0.87
78 0.89
79 0.9
80 0.91
81 0.9
82 0.91
83 0.9
84 0.89
85 0.84
86 0.76
87 0.67
88 0.56
89 0.46
90 0.36
91 0.26
92 0.16
93 0.1
94 0.08
95 0.07
96 0.07
97 0.06