Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1DAE3

Protein Details
Accession A0A2V1DAE3    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
182-201FTRARRPKAAAQVLRNRWRLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14, cyto_nucl 12.5, nucl 9, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR023232  Glyco_hydro_2_AS  
IPR006103  Glyco_hydro_2_cat  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF02836  Glyco_hydro_2_C  
PROSITE View protein in PROSITE  
PS00608  GLYCOSYL_HYDROL_F2_2  
Amino Acid Sequences MQNYLSVFVHPDTKTAAHEQGIRELISRDKNHSCVVMWSIVNEPGSHENGAREYFEPLVSITRELDSRPVSFAYFSLATSEKDQISDIFDVLCLNRYYGWYENCRYLTLVETEVEKDLRGWQDKYGKPKIIIEYKHQSYILEIYHLVLDRLERVVGEHVWTFADFQTSQLVFCVDGNKKGVFTRARRPKAAAQVLRNRWRLEGEGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.29
4 0.25
5 0.29
6 0.29
7 0.32
8 0.33
9 0.3
10 0.27
11 0.25
12 0.28
13 0.32
14 0.33
15 0.33
16 0.35
17 0.38
18 0.39
19 0.38
20 0.34
21 0.28
22 0.29
23 0.27
24 0.22
25 0.2
26 0.21
27 0.21
28 0.21
29 0.18
30 0.18
31 0.16
32 0.19
33 0.18
34 0.17
35 0.16
36 0.17
37 0.18
38 0.17
39 0.15
40 0.15
41 0.15
42 0.14
43 0.13
44 0.11
45 0.13
46 0.12
47 0.12
48 0.11
49 0.11
50 0.11
51 0.11
52 0.15
53 0.15
54 0.15
55 0.15
56 0.15
57 0.15
58 0.15
59 0.14
60 0.13
61 0.12
62 0.11
63 0.12
64 0.12
65 0.13
66 0.15
67 0.17
68 0.13
69 0.13
70 0.13
71 0.11
72 0.13
73 0.12
74 0.1
75 0.08
76 0.08
77 0.08
78 0.07
79 0.1
80 0.07
81 0.07
82 0.07
83 0.08
84 0.1
85 0.14
86 0.16
87 0.17
88 0.19
89 0.22
90 0.22
91 0.22
92 0.2
93 0.17
94 0.16
95 0.13
96 0.13
97 0.1
98 0.1
99 0.1
100 0.1
101 0.1
102 0.08
103 0.08
104 0.1
105 0.13
106 0.15
107 0.16
108 0.19
109 0.28
110 0.31
111 0.39
112 0.42
113 0.42
114 0.4
115 0.43
116 0.44
117 0.43
118 0.43
119 0.42
120 0.44
121 0.43
122 0.44
123 0.41
124 0.35
125 0.28
126 0.29
127 0.22
128 0.14
129 0.12
130 0.11
131 0.12
132 0.12
133 0.11
134 0.08
135 0.08
136 0.08
137 0.09
138 0.08
139 0.06
140 0.08
141 0.1
142 0.1
143 0.12
144 0.11
145 0.11
146 0.12
147 0.12
148 0.12
149 0.1
150 0.13
151 0.11
152 0.11
153 0.17
154 0.16
155 0.16
156 0.16
157 0.16
158 0.13
159 0.14
160 0.2
161 0.16
162 0.2
163 0.23
164 0.23
165 0.24
166 0.25
167 0.31
168 0.32
169 0.36
170 0.43
171 0.51
172 0.58
173 0.6
174 0.65
175 0.66
176 0.68
177 0.73
178 0.7
179 0.68
180 0.72
181 0.78
182 0.82
183 0.79
184 0.69
185 0.61
186 0.56