Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1D421

Protein Details
Accession A0A2V1D421    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
23-55QNRHSKSRAQKACNNCRKRKVKCSGERPRCRDCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MDKRPPPPKLAILRLAYERKSPQNRHSKSRAQKACNNCRKRKVKCSGERPRCRDCVNQHVPCIYSQARKDRLRESVSGTPLTNPAKGYRPEQSARCVSKRSKCTC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.44
5 0.43
6 0.45
7 0.51
8 0.54
9 0.57
10 0.63
11 0.66
12 0.69
13 0.72
14 0.73
15 0.73
16 0.77
17 0.77
18 0.72
19 0.74
20 0.76
21 0.8
22 0.8
23 0.8
24 0.77
25 0.79
26 0.82
27 0.82
28 0.82
29 0.81
30 0.82
31 0.81
32 0.85
33 0.86
34 0.87
35 0.89
36 0.84
37 0.79
38 0.72
39 0.66
40 0.61
41 0.55
42 0.55
43 0.55
44 0.51
45 0.47
46 0.44
47 0.42
48 0.36
49 0.35
50 0.27
51 0.23
52 0.24
53 0.31
54 0.39
55 0.42
56 0.46
57 0.46
58 0.5
59 0.49
60 0.47
61 0.45
62 0.43
63 0.42
64 0.4
65 0.36
66 0.3
67 0.32
68 0.32
69 0.27
70 0.21
71 0.22
72 0.26
73 0.29
74 0.32
75 0.33
76 0.38
77 0.42
78 0.44
79 0.49
80 0.51
81 0.56
82 0.56
83 0.57
84 0.58
85 0.62