Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DSI8

Protein Details
Accession A0A2V1DSI8    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
54-83SSANTTSKAKPKPKPQPKSKSKPTPTPQTPHydrophilic
NLS Segment(s)
PositionSequence
60-76SKAKPKPKPQPKSKSKP
184-195GKGKGGGGKRKR
209-221KGKGKGKRVKFEK
Subcellular Location(s) nucl 16, cyto_nucl 11.5, mito 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MNNPCKAKTPTSNKQLAQSTRPSSSSTIGTSSKKQKTSHGRAATSSTTKPPSKSSANTTSKAKPKPKPQPKSKSKPTPTPQTPSTSTRPKRTPCTTPPTPLPGLPDYTPYTYAELAALCSQRNIMTTGNTASLRGLLIQDDINVVKGFPRDAKNYGNERTRGRKTVAPVVPGAPQAEPAVWIGGKGKGGGGKRKREEDMEEVVQVVEGKGKGKGKRVKFEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.72
3 0.67
4 0.63
5 0.62
6 0.57
7 0.53
8 0.52
9 0.47
10 0.41
11 0.39
12 0.35
13 0.28
14 0.28
15 0.28
16 0.31
17 0.36
18 0.43
19 0.47
20 0.5
21 0.5
22 0.55
23 0.62
24 0.68
25 0.71
26 0.69
27 0.64
28 0.6
29 0.63
30 0.58
31 0.52
32 0.44
33 0.39
34 0.38
35 0.38
36 0.38
37 0.37
38 0.38
39 0.4
40 0.41
41 0.44
42 0.48
43 0.51
44 0.52
45 0.54
46 0.55
47 0.57
48 0.62
49 0.63
50 0.6
51 0.65
52 0.73
53 0.79
54 0.82
55 0.85
56 0.87
57 0.89
58 0.92
59 0.92
60 0.92
61 0.88
62 0.87
63 0.84
64 0.83
65 0.78
66 0.74
67 0.66
68 0.61
69 0.58
70 0.53
71 0.52
72 0.52
73 0.51
74 0.53
75 0.57
76 0.56
77 0.61
78 0.61
79 0.62
80 0.59
81 0.63
82 0.58
83 0.55
84 0.53
85 0.5
86 0.46
87 0.38
88 0.35
89 0.27
90 0.26
91 0.21
92 0.22
93 0.18
94 0.18
95 0.19
96 0.16
97 0.16
98 0.13
99 0.13
100 0.1
101 0.08
102 0.08
103 0.09
104 0.09
105 0.07
106 0.07
107 0.08
108 0.08
109 0.08
110 0.1
111 0.08
112 0.09
113 0.1
114 0.11
115 0.13
116 0.13
117 0.12
118 0.1
119 0.1
120 0.09
121 0.08
122 0.07
123 0.05
124 0.06
125 0.06
126 0.06
127 0.07
128 0.07
129 0.08
130 0.07
131 0.07
132 0.08
133 0.08
134 0.09
135 0.13
136 0.17
137 0.19
138 0.23
139 0.27
140 0.33
141 0.38
142 0.43
143 0.45
144 0.45
145 0.47
146 0.53
147 0.54
148 0.51
149 0.48
150 0.46
151 0.44
152 0.5
153 0.48
154 0.42
155 0.38
156 0.36
157 0.34
158 0.32
159 0.28
160 0.18
161 0.16
162 0.14
163 0.12
164 0.12
165 0.1
166 0.11
167 0.09
168 0.1
169 0.1
170 0.12
171 0.12
172 0.11
173 0.12
174 0.15
175 0.2
176 0.3
177 0.37
178 0.45
179 0.51
180 0.57
181 0.59
182 0.59
183 0.6
184 0.55
185 0.55
186 0.47
187 0.42
188 0.36
189 0.32
190 0.28
191 0.23
192 0.17
193 0.13
194 0.11
195 0.12
196 0.17
197 0.24
198 0.27
199 0.37
200 0.46
201 0.51