Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DPM5

Protein Details
Accession A0A2V1DPM5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
43-62PPTSGRSKTHSKPYNPREHVHydrophilic
250-273KYKAHDRRSTRDRSHSRSRRDSYNBasic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MALAYFCERNSQSGLGYGSPSSAAPNAFGQSYDQPYYPQAPTPPTSGRSKTHSKPYNPREHVPKDSKQQHFRQTKFLAAVGGALAGGVGGRALGRDKYGTLAGAAAGAFSGPVIMDKFMERKKNKNSDEVALYDGNRPRSHSQKLLEDNVDYYASRSDGEYDRRRRHNQARSRDYRDDYDDYDYDHNRRGRSHRPDRGYSNYDDGRKSRGYSTSPTRSKTGYGLRARSKSIVDRFRAKITGGAVTDGESKYKAHDRRSTRDRSHSRSRRDSYNDYYTDSEEDAQSRRGDRRSWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.21
3 0.22
4 0.19
5 0.16
6 0.15
7 0.15
8 0.13
9 0.13
10 0.12
11 0.12
12 0.14
13 0.15
14 0.15
15 0.15
16 0.17
17 0.19
18 0.24
19 0.25
20 0.23
21 0.23
22 0.26
23 0.3
24 0.28
25 0.27
26 0.25
27 0.28
28 0.3
29 0.33
30 0.35
31 0.34
32 0.4
33 0.41
34 0.42
35 0.43
36 0.5
37 0.51
38 0.57
39 0.62
40 0.64
41 0.7
42 0.77
43 0.81
44 0.78
45 0.78
46 0.77
47 0.75
48 0.76
49 0.72
50 0.69
51 0.68
52 0.72
53 0.75
54 0.74
55 0.75
56 0.75
57 0.77
58 0.73
59 0.72
60 0.64
61 0.6
62 0.53
63 0.45
64 0.36
65 0.26
66 0.24
67 0.14
68 0.12
69 0.07
70 0.05
71 0.04
72 0.03
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.03
79 0.04
80 0.05
81 0.06
82 0.07
83 0.07
84 0.09
85 0.1
86 0.1
87 0.08
88 0.08
89 0.07
90 0.07
91 0.06
92 0.04
93 0.04
94 0.03
95 0.03
96 0.02
97 0.02
98 0.02
99 0.03
100 0.03
101 0.04
102 0.05
103 0.06
104 0.11
105 0.15
106 0.25
107 0.27
108 0.35
109 0.44
110 0.54
111 0.55
112 0.58
113 0.57
114 0.51
115 0.51
116 0.44
117 0.37
118 0.28
119 0.26
120 0.23
121 0.23
122 0.22
123 0.2
124 0.23
125 0.23
126 0.28
127 0.31
128 0.31
129 0.32
130 0.36
131 0.39
132 0.39
133 0.37
134 0.31
135 0.28
136 0.24
137 0.21
138 0.14
139 0.11
140 0.08
141 0.07
142 0.07
143 0.07
144 0.08
145 0.11
146 0.19
147 0.27
148 0.35
149 0.42
150 0.49
151 0.54
152 0.6
153 0.67
154 0.69
155 0.7
156 0.72
157 0.75
158 0.76
159 0.79
160 0.76
161 0.69
162 0.62
163 0.58
164 0.5
165 0.41
166 0.38
167 0.3
168 0.27
169 0.28
170 0.26
171 0.23
172 0.26
173 0.27
174 0.24
175 0.28
176 0.32
177 0.39
178 0.48
179 0.57
180 0.59
181 0.63
182 0.67
183 0.69
184 0.7
185 0.65
186 0.56
187 0.53
188 0.49
189 0.45
190 0.42
191 0.37
192 0.34
193 0.32
194 0.31
195 0.28
196 0.28
197 0.28
198 0.32
199 0.4
200 0.46
201 0.49
202 0.5
203 0.49
204 0.45
205 0.44
206 0.44
207 0.43
208 0.42
209 0.44
210 0.49
211 0.54
212 0.55
213 0.56
214 0.52
215 0.47
216 0.46
217 0.48
218 0.48
219 0.46
220 0.51
221 0.52
222 0.53
223 0.52
224 0.44
225 0.38
226 0.32
227 0.32
228 0.25
229 0.23
230 0.19
231 0.19
232 0.22
233 0.19
234 0.18
235 0.14
236 0.14
237 0.17
238 0.26
239 0.3
240 0.35
241 0.43
242 0.5
243 0.6
244 0.69
245 0.74
246 0.73
247 0.78
248 0.79
249 0.79
250 0.83
251 0.82
252 0.83
253 0.83
254 0.81
255 0.79
256 0.78
257 0.78
258 0.74
259 0.74
260 0.66
261 0.6
262 0.57
263 0.49
264 0.43
265 0.37
266 0.3
267 0.23
268 0.23
269 0.22
270 0.23
271 0.25
272 0.27
273 0.32
274 0.35