Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DJZ9

Protein Details
Accession A0A2V1DJZ9    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
265-292KDLTVRIESKKQRNKNTKQTRVVKKTVPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14, nucl 13.5, cyto 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037231  NAP-like_sf  
IPR002164  NAP_family  
Gene Ontology GO:0005634  C:nucleus  
GO:0006334  P:nucleosome assembly  
Pfam View protein in Pfam  
PF00956  NAP  
Amino Acid Sequences MSEPIRNKKMDSITAPTPQNTPANAAPISSRAQQPGVASIKEEDISAAAGLFAANPALVHMMQAKLGSLVGRSSGYIESLPVSVRRRVAGLKGIQKDHAKLEAEFQEEVLQLEKKYFAKFTPLYQSRAKIVNGESEPSEEQVKVGETKDDEDEDENPVPEDEINKDEGKDVKGIPEFWLSAMKNQISLAEMITDRDEAALKSLSDVRMEYLDRPGFRLIFEFEENEFFTNKTITKTYFYQEENGYGGDFIYDHAEGDKIDWKAGKDLTVRIESKKQRNKNTKQTRVVKKTVPTESFFNFFDPPKPPQEDDDGSSDIEERLELDYQLGEDIKEKLIPRAIDWFTGEALQYENIEDFDEGEFEDEDDDDEDELSDERDEDEDSDEEGDGTKPKQEAAECKQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.5
4 0.45
5 0.43
6 0.41
7 0.35
8 0.35
9 0.29
10 0.31
11 0.29
12 0.28
13 0.25
14 0.24
15 0.26
16 0.25
17 0.26
18 0.24
19 0.25
20 0.27
21 0.27
22 0.32
23 0.32
24 0.28
25 0.26
26 0.25
27 0.26
28 0.24
29 0.23
30 0.15
31 0.11
32 0.11
33 0.1
34 0.08
35 0.06
36 0.06
37 0.05
38 0.05
39 0.05
40 0.04
41 0.04
42 0.04
43 0.04
44 0.06
45 0.06
46 0.07
47 0.09
48 0.1
49 0.11
50 0.11
51 0.11
52 0.09
53 0.1
54 0.09
55 0.08
56 0.08
57 0.08
58 0.09
59 0.09
60 0.1
61 0.1
62 0.11
63 0.1
64 0.11
65 0.1
66 0.11
67 0.12
68 0.15
69 0.18
70 0.2
71 0.22
72 0.22
73 0.24
74 0.25
75 0.28
76 0.3
77 0.34
78 0.39
79 0.43
80 0.44
81 0.46
82 0.47
83 0.46
84 0.41
85 0.39
86 0.33
87 0.27
88 0.31
89 0.3
90 0.3
91 0.28
92 0.25
93 0.22
94 0.2
95 0.2
96 0.17
97 0.14
98 0.11
99 0.12
100 0.15
101 0.15
102 0.16
103 0.17
104 0.16
105 0.23
106 0.24
107 0.27
108 0.35
109 0.36
110 0.39
111 0.41
112 0.43
113 0.38
114 0.41
115 0.37
116 0.3
117 0.28
118 0.31
119 0.28
120 0.27
121 0.24
122 0.22
123 0.23
124 0.2
125 0.2
126 0.12
127 0.12
128 0.11
129 0.12
130 0.11
131 0.11
132 0.12
133 0.11
134 0.13
135 0.14
136 0.14
137 0.13
138 0.13
139 0.14
140 0.15
141 0.16
142 0.14
143 0.13
144 0.12
145 0.11
146 0.1
147 0.11
148 0.08
149 0.09
150 0.12
151 0.12
152 0.12
153 0.14
154 0.16
155 0.16
156 0.16
157 0.15
158 0.16
159 0.17
160 0.18
161 0.17
162 0.17
163 0.16
164 0.14
165 0.19
166 0.15
167 0.16
168 0.19
169 0.17
170 0.16
171 0.16
172 0.16
173 0.11
174 0.11
175 0.09
176 0.07
177 0.07
178 0.07
179 0.08
180 0.07
181 0.06
182 0.06
183 0.07
184 0.05
185 0.07
186 0.07
187 0.06
188 0.07
189 0.1
190 0.1
191 0.1
192 0.1
193 0.09
194 0.1
195 0.11
196 0.11
197 0.14
198 0.16
199 0.15
200 0.17
201 0.18
202 0.16
203 0.15
204 0.16
205 0.12
206 0.13
207 0.13
208 0.13
209 0.12
210 0.14
211 0.14
212 0.14
213 0.12
214 0.1
215 0.1
216 0.1
217 0.1
218 0.11
219 0.12
220 0.13
221 0.16
222 0.18
223 0.19
224 0.23
225 0.23
226 0.25
227 0.24
228 0.23
229 0.21
230 0.19
231 0.17
232 0.11
233 0.1
234 0.07
235 0.06
236 0.05
237 0.06
238 0.06
239 0.06
240 0.06
241 0.07
242 0.06
243 0.08
244 0.13
245 0.11
246 0.13
247 0.14
248 0.14
249 0.18
250 0.18
251 0.21
252 0.18
253 0.2
254 0.23
255 0.28
256 0.29
257 0.28
258 0.37
259 0.41
260 0.5
261 0.57
262 0.61
263 0.66
264 0.75
265 0.82
266 0.84
267 0.87
268 0.87
269 0.88
270 0.9
271 0.9
272 0.87
273 0.84
274 0.78
275 0.73
276 0.71
277 0.69
278 0.62
279 0.54
280 0.5
281 0.46
282 0.44
283 0.38
284 0.32
285 0.26
286 0.24
287 0.25
288 0.25
289 0.27
290 0.3
291 0.34
292 0.33
293 0.34
294 0.4
295 0.39
296 0.37
297 0.38
298 0.32
299 0.28
300 0.26
301 0.25
302 0.17
303 0.14
304 0.11
305 0.08
306 0.08
307 0.09
308 0.09
309 0.09
310 0.09
311 0.09
312 0.1
313 0.1
314 0.08
315 0.09
316 0.11
317 0.11
318 0.14
319 0.15
320 0.18
321 0.22
322 0.23
323 0.22
324 0.29
325 0.3
326 0.28
327 0.29
328 0.27
329 0.23
330 0.23
331 0.21
332 0.13
333 0.14
334 0.12
335 0.11
336 0.1
337 0.1
338 0.09
339 0.1
340 0.1
341 0.1
342 0.09
343 0.09
344 0.08
345 0.09
346 0.09
347 0.08
348 0.09
349 0.08
350 0.08
351 0.09
352 0.09
353 0.08
354 0.08
355 0.08
356 0.08
357 0.09
358 0.09
359 0.08
360 0.08
361 0.08
362 0.09
363 0.1
364 0.1
365 0.13
366 0.13
367 0.14
368 0.15
369 0.14
370 0.13
371 0.13
372 0.14
373 0.13
374 0.14
375 0.17
376 0.16
377 0.18
378 0.23
379 0.27
380 0.35