Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LAJ1

Protein Details
Accession E2LAJ1    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
86-127AEMNEEKEKKEKKKEKKRKRGEEKEEKKKRRRKAEDGDEEDKBasic
NLS Segment(s)
PositionSequence
92-119KEKKEKKKEKKRKRGEEKEEKKKRRRKA
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000467  G_patch_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG mpr:MPER_03095  -  
Pfam View protein in Pfam  
PF01585  G-patch  
PROSITE View protein in PROSITE  
PS50174  G_PATCH  
Amino Acid Sequences ASKFGATYLAKFGWSSSQGLGVSGEGRTSHVKVNQKLDMLGIGAAQSKDPNGIAWKQNKDFENLLRRLNADVTENGQSEKDEGEDAEMNEEKEKKEKKKEKKRKRGEEKEEKKKRRRKAEDGDEEDKAGFEGNTSGPAEVSPPETPSTQSKTPVIPRHRSHRARHIAAKSFASKSAAAISEILGISSASSSSATTAAATPSGSLTPIESDANLEKLTTSKKVSPTTSRNVYWRKLPENHAAVPSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.18
4 0.22
5 0.21
6 0.22
7 0.21
8 0.16
9 0.15
10 0.13
11 0.13
12 0.09
13 0.11
14 0.14
15 0.15
16 0.2
17 0.25
18 0.34
19 0.39
20 0.45
21 0.47
22 0.45
23 0.43
24 0.39
25 0.33
26 0.25
27 0.19
28 0.12
29 0.09
30 0.1
31 0.1
32 0.09
33 0.09
34 0.09
35 0.1
36 0.1
37 0.11
38 0.13
39 0.17
40 0.24
41 0.31
42 0.38
43 0.4
44 0.46
45 0.46
46 0.46
47 0.45
48 0.45
49 0.47
50 0.43
51 0.41
52 0.37
53 0.37
54 0.33
55 0.32
56 0.25
57 0.18
58 0.16
59 0.17
60 0.19
61 0.18
62 0.17
63 0.16
64 0.15
65 0.13
66 0.12
67 0.1
68 0.07
69 0.07
70 0.09
71 0.1
72 0.1
73 0.12
74 0.13
75 0.12
76 0.14
77 0.16
78 0.14
79 0.2
80 0.27
81 0.32
82 0.42
83 0.52
84 0.61
85 0.71
86 0.82
87 0.86
88 0.9
89 0.94
90 0.94
91 0.96
92 0.95
93 0.95
94 0.95
95 0.94
96 0.94
97 0.93
98 0.92
99 0.9
100 0.88
101 0.85
102 0.85
103 0.84
104 0.83
105 0.82
106 0.83
107 0.83
108 0.82
109 0.77
110 0.66
111 0.57
112 0.47
113 0.36
114 0.25
115 0.15
116 0.07
117 0.04
118 0.05
119 0.05
120 0.07
121 0.07
122 0.07
123 0.07
124 0.07
125 0.07
126 0.07
127 0.1
128 0.08
129 0.09
130 0.11
131 0.11
132 0.13
133 0.17
134 0.22
135 0.21
136 0.23
137 0.24
138 0.27
139 0.34
140 0.41
141 0.44
142 0.47
143 0.5
144 0.56
145 0.65
146 0.68
147 0.67
148 0.69
149 0.71
150 0.68
151 0.72
152 0.7
153 0.66
154 0.61
155 0.59
156 0.52
157 0.44
158 0.39
159 0.33
160 0.26
161 0.2
162 0.21
163 0.18
164 0.15
165 0.14
166 0.13
167 0.13
168 0.13
169 0.12
170 0.08
171 0.07
172 0.07
173 0.06
174 0.06
175 0.04
176 0.05
177 0.05
178 0.06
179 0.06
180 0.06
181 0.07
182 0.08
183 0.08
184 0.08
185 0.08
186 0.08
187 0.08
188 0.08
189 0.08
190 0.08
191 0.08
192 0.09
193 0.11
194 0.11
195 0.1
196 0.13
197 0.14
198 0.16
199 0.15
200 0.13
201 0.12
202 0.15
203 0.18
204 0.2
205 0.23
206 0.26
207 0.33
208 0.4
209 0.45
210 0.52
211 0.56
212 0.61
213 0.63
214 0.62
215 0.64
216 0.65
217 0.63
218 0.63
219 0.64
220 0.63
221 0.62
222 0.65
223 0.65
224 0.64
225 0.64