Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1E409

Protein Details
Accession A0A2V1E409   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
33-59MINWSCEWERRKRRRERRKIQIKVLLAHydrophilic
NLS Segment(s)
PositionSequence
42-56RRKRRRERRKIQIKV
Subcellular Location(s) cyto 12, mito 8, nucl 3, plas 2
Family & Domain DBs
Amino Acid Sequences MCGGVCRFEVVLLFGCVPGVRGSSPVVGVMVVMINWSCEWERRKRRRERRKIQIKVLLASRGKTKPLIGSDLACKIPQIQRRPSTKIRNLEVLLRLVLLLGGFLKRPLCSNDATLNVHTYPTLIHIHFIGGRFFVGAGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.11
4 0.12
5 0.1
6 0.09
7 0.08
8 0.09
9 0.11
10 0.12
11 0.12
12 0.11
13 0.11
14 0.09
15 0.08
16 0.07
17 0.06
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.06
24 0.07
25 0.12
26 0.17
27 0.27
28 0.38
29 0.48
30 0.59
31 0.68
32 0.79
33 0.86
34 0.93
35 0.93
36 0.93
37 0.94
38 0.92
39 0.89
40 0.86
41 0.76
42 0.68
43 0.6
44 0.55
45 0.44
46 0.37
47 0.34
48 0.27
49 0.26
50 0.23
51 0.22
52 0.19
53 0.2
54 0.22
55 0.17
56 0.17
57 0.18
58 0.2
59 0.19
60 0.15
61 0.14
62 0.13
63 0.18
64 0.23
65 0.27
66 0.33
67 0.4
68 0.45
69 0.52
70 0.58
71 0.63
72 0.65
73 0.65
74 0.61
75 0.59
76 0.55
77 0.52
78 0.46
79 0.37
80 0.29
81 0.22
82 0.19
83 0.12
84 0.11
85 0.07
86 0.05
87 0.04
88 0.04
89 0.05
90 0.06
91 0.07
92 0.08
93 0.1
94 0.13
95 0.15
96 0.17
97 0.21
98 0.24
99 0.28
100 0.3
101 0.29
102 0.29
103 0.27
104 0.25
105 0.21
106 0.17
107 0.12
108 0.13
109 0.16
110 0.13
111 0.14
112 0.14
113 0.17
114 0.19
115 0.2
116 0.18
117 0.14
118 0.14
119 0.13