Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DHM0

Protein Details
Accession A0A2V1DHM0    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MQKRRRVTRACDECRRKKIKCDGKQPCTHCTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MQKRRRVTRACDECRRKKIKCDGKQPCTHCTVYSYGMLFSISTSPMRLAYSHGVAQNVPTTNHQTDAELRRLSTSRPSRPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.8
4 0.78
5 0.8
6 0.8
7 0.79
8 0.8
9 0.81
10 0.81
11 0.86
12 0.8
13 0.73
14 0.67
15 0.59
16 0.48
17 0.39
18 0.33
19 0.26
20 0.24
21 0.2
22 0.15
23 0.14
24 0.14
25 0.11
26 0.09
27 0.07
28 0.06
29 0.06
30 0.06
31 0.06
32 0.07
33 0.08
34 0.07
35 0.1
36 0.11
37 0.14
38 0.16
39 0.17
40 0.16
41 0.16
42 0.17
43 0.18
44 0.17
45 0.16
46 0.16
47 0.21
48 0.21
49 0.24
50 0.24
51 0.22
52 0.28
53 0.32
54 0.36
55 0.31
56 0.3
57 0.32
58 0.33
59 0.33
60 0.36
61 0.4