Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1D9P7

Protein Details
Accession A0A2V1D9P7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
66-85CVILWLVKRRQNKKKISGGHHydrophilic
NLS Segment(s)
PositionSequence
30-45RGKKSGGGKKAGGKKK
77-80NKKK
Subcellular Location(s) cyto 10, mito 7, plas 5, cyto_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPALSQPALLRRAVEDPYAIAYEAMALVARGKKSGGGKKAGGKKKTSVGAIVGIIIAIIIIIIIICVILWLVKRRQNKKKISGGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.17
3 0.15
4 0.17
5 0.17
6 0.15
7 0.11
8 0.09
9 0.08
10 0.08
11 0.07
12 0.04
13 0.03
14 0.06
15 0.08
16 0.08
17 0.09
18 0.09
19 0.12
20 0.18
21 0.25
22 0.27
23 0.29
24 0.32
25 0.38
26 0.48
27 0.52
28 0.49
29 0.45
30 0.43
31 0.44
32 0.44
33 0.38
34 0.29
35 0.23
36 0.21
37 0.19
38 0.16
39 0.11
40 0.08
41 0.07
42 0.05
43 0.04
44 0.02
45 0.02
46 0.01
47 0.01
48 0.01
49 0.01
50 0.01
51 0.01
52 0.01
53 0.02
54 0.02
55 0.03
56 0.05
57 0.11
58 0.17
59 0.24
60 0.34
61 0.45
62 0.55
63 0.65
64 0.73
65 0.78