Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1D7Q9

Protein Details
Accession A0A2V1D7Q9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MDKKMEEKKKSIWTRKRDLVYLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, E.R. 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR033118  EXPERA  
IPR016964  Sigma2_recept  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF05241  EBP  
PROSITE View protein in PROSITE  
PS51751  EXPERA  
Amino Acid Sequences MDKKMEEKKKSIWTRKRDLVYLVFFVVHVPVMLCFDLTHYYPTSLKPTFMTSLREWYIATYNDRFFYNPPPWFALLTLLELTYHLPLTLWAIPALLRNDARIPLALLVFGLETSVSTLVCMAEMWSWEELSAAQRGVGGLGGMYGGYAAVGVFMVVDCYLRLDRILAKQKGIEPVSGKKAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.81
4 0.74
5 0.68
6 0.64
7 0.59
8 0.51
9 0.42
10 0.33
11 0.28
12 0.25
13 0.2
14 0.12
15 0.08
16 0.06
17 0.06
18 0.08
19 0.08
20 0.07
21 0.07
22 0.08
23 0.11
24 0.11
25 0.14
26 0.13
27 0.15
28 0.16
29 0.18
30 0.23
31 0.21
32 0.22
33 0.2
34 0.23
35 0.24
36 0.25
37 0.28
38 0.23
39 0.29
40 0.29
41 0.28
42 0.25
43 0.23
44 0.24
45 0.21
46 0.23
47 0.2
48 0.2
49 0.21
50 0.22
51 0.21
52 0.19
53 0.23
54 0.27
55 0.25
56 0.26
57 0.27
58 0.28
59 0.27
60 0.26
61 0.22
62 0.15
63 0.15
64 0.13
65 0.1
66 0.09
67 0.09
68 0.09
69 0.06
70 0.06
71 0.04
72 0.04
73 0.04
74 0.07
75 0.08
76 0.07
77 0.07
78 0.07
79 0.07
80 0.1
81 0.11
82 0.1
83 0.09
84 0.1
85 0.11
86 0.12
87 0.12
88 0.09
89 0.09
90 0.08
91 0.08
92 0.07
93 0.06
94 0.05
95 0.05
96 0.04
97 0.04
98 0.03
99 0.03
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.05
111 0.07
112 0.07
113 0.07
114 0.07
115 0.07
116 0.07
117 0.09
118 0.1
119 0.08
120 0.07
121 0.08
122 0.08
123 0.08
124 0.07
125 0.05
126 0.04
127 0.03
128 0.03
129 0.03
130 0.03
131 0.02
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.02
141 0.03
142 0.04
143 0.04
144 0.04
145 0.07
146 0.08
147 0.09
148 0.09
149 0.11
150 0.15
151 0.24
152 0.35
153 0.34
154 0.36
155 0.4
156 0.43
157 0.5
158 0.47
159 0.42
160 0.37
161 0.42