Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1CXN2

Protein Details
Accession A0A2V1CXN2    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
49-78QKERRRIQNRIAQRRYRKKAKAKKEALSCAHydrophilic
NLS Segment(s)
PositionSequence
51-72ERRRIQNRIAQRRYRKKAKAKK
Subcellular Location(s) nucl 20, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MLARYNTYRQRNRVASAICSQLRKNSMDCYSNAAVTGNADEEWAHVHDQKERRRIQNRIAQRRYRKKAKAKKEALSCAQPVVPARPFSPPSTRDSESAGVEWAQIWHRDTRHCYTCKIGTIPEGWEPPSAGPVAPQHSLVHASWSLSSLYQQPPNPANGAYQCFPASLSAQAAQFKGMLRLREGGMSLWRPMPQQSYIEEGRALPGIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.54
3 0.5
4 0.52
5 0.46
6 0.44
7 0.42
8 0.4
9 0.41
10 0.39
11 0.37
12 0.36
13 0.38
14 0.38
15 0.37
16 0.38
17 0.36
18 0.33
19 0.31
20 0.25
21 0.19
22 0.16
23 0.16
24 0.1
25 0.08
26 0.08
27 0.07
28 0.07
29 0.09
30 0.1
31 0.11
32 0.13
33 0.14
34 0.21
35 0.29
36 0.37
37 0.44
38 0.49
39 0.57
40 0.63
41 0.67
42 0.69
43 0.7
44 0.74
45 0.76
46 0.78
47 0.77
48 0.8
49 0.85
50 0.85
51 0.86
52 0.85
53 0.85
54 0.86
55 0.88
56 0.88
57 0.86
58 0.84
59 0.82
60 0.79
61 0.73
62 0.67
63 0.56
64 0.47
65 0.38
66 0.32
67 0.25
68 0.22
69 0.2
70 0.16
71 0.17
72 0.2
73 0.22
74 0.23
75 0.28
76 0.27
77 0.28
78 0.33
79 0.34
80 0.3
81 0.32
82 0.31
83 0.25
84 0.23
85 0.19
86 0.13
87 0.11
88 0.1
89 0.08
90 0.07
91 0.07
92 0.08
93 0.11
94 0.12
95 0.15
96 0.2
97 0.25
98 0.31
99 0.32
100 0.32
101 0.33
102 0.35
103 0.34
104 0.31
105 0.26
106 0.2
107 0.2
108 0.2
109 0.19
110 0.17
111 0.15
112 0.15
113 0.14
114 0.13
115 0.12
116 0.11
117 0.08
118 0.09
119 0.1
120 0.13
121 0.13
122 0.14
123 0.14
124 0.14
125 0.17
126 0.15
127 0.16
128 0.13
129 0.13
130 0.12
131 0.13
132 0.13
133 0.1
134 0.11
135 0.13
136 0.16
137 0.21
138 0.23
139 0.26
140 0.28
141 0.3
142 0.3
143 0.26
144 0.25
145 0.23
146 0.26
147 0.22
148 0.22
149 0.2
150 0.19
151 0.19
152 0.17
153 0.15
154 0.12
155 0.13
156 0.13
157 0.15
158 0.17
159 0.17
160 0.16
161 0.16
162 0.16
163 0.21
164 0.22
165 0.22
166 0.22
167 0.24
168 0.25
169 0.25
170 0.25
171 0.2
172 0.23
173 0.23
174 0.23
175 0.23
176 0.24
177 0.24
178 0.26
179 0.28
180 0.25
181 0.26
182 0.26
183 0.3
184 0.3
185 0.3
186 0.29
187 0.25
188 0.23