Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1D956

Protein Details
Accession A0A2V1D956   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-30VPDPTPKPLSHKKRFKCSQCDKAYTRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MSFDVPDPTPKPLSHKKRFKCSQCDKAYTRKFILQEHERTHTGEKPEHCPKCPKSYARKSDLQRHIKTCGSITKAIYNCHVCSAGFSRNNALKKHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.66
3 0.7
4 0.77
5 0.86
6 0.87
7 0.87
8 0.86
9 0.86
10 0.84
11 0.84
12 0.76
13 0.77
14 0.75
15 0.7
16 0.62
17 0.56
18 0.5
19 0.45
20 0.5
21 0.47
22 0.46
23 0.44
24 0.46
25 0.42
26 0.41
27 0.4
28 0.36
29 0.31
30 0.29
31 0.27
32 0.3
33 0.39
34 0.39
35 0.39
36 0.44
37 0.44
38 0.48
39 0.52
40 0.52
41 0.54
42 0.62
43 0.68
44 0.66
45 0.7
46 0.67
47 0.71
48 0.74
49 0.73
50 0.68
51 0.63
52 0.62
53 0.56
54 0.51
55 0.44
56 0.4
57 0.34
58 0.32
59 0.31
60 0.34
61 0.35
62 0.35
63 0.38
64 0.36
65 0.33
66 0.32
67 0.31
68 0.23
69 0.25
70 0.28
71 0.31
72 0.3
73 0.31
74 0.36
75 0.41
76 0.47