Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1D4C2

Protein Details
Accession A0A2V1D4C2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-75GQPVRIKKRPTKPPGKNWSKDFHydrophilic
NLS Segment(s)
PositionSequence
59-70IKKRPTKPPGKN
Subcellular Location(s) mito 16, nucl 5, pero 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MDKASRALAQGVPLGVPTSYRALADHSGAKEQQYLKDYEEAALVNFLLQLSDLGQPVRIKKRPTKPPGKNWSKDFRDRHPDVEARRVQALDWNRHEKHIYSKVVHCCSGREYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.1
3 0.1
4 0.1
5 0.11
6 0.12
7 0.12
8 0.12
9 0.15
10 0.16
11 0.18
12 0.21
13 0.19
14 0.21
15 0.22
16 0.22
17 0.23
18 0.23
19 0.25
20 0.23
21 0.23
22 0.22
23 0.25
24 0.24
25 0.2
26 0.2
27 0.15
28 0.13
29 0.11
30 0.09
31 0.06
32 0.05
33 0.05
34 0.04
35 0.03
36 0.03
37 0.04
38 0.06
39 0.06
40 0.06
41 0.08
42 0.09
43 0.14
44 0.21
45 0.23
46 0.27
47 0.35
48 0.45
49 0.54
50 0.62
51 0.69
52 0.71
53 0.78
54 0.84
55 0.86
56 0.82
57 0.79
58 0.79
59 0.75
60 0.75
61 0.69
62 0.67
63 0.67
64 0.63
65 0.6
66 0.56
67 0.54
68 0.48
69 0.53
70 0.47
71 0.4
72 0.4
73 0.37
74 0.31
75 0.32
76 0.36
77 0.35
78 0.39
79 0.45
80 0.44
81 0.47
82 0.5
83 0.45
84 0.48
85 0.48
86 0.47
87 0.43
88 0.5
89 0.56
90 0.59
91 0.61
92 0.52
93 0.46