Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1D0X2

Protein Details
Accession A0A2V1D0X2   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-37QFPYRHVHCRWTARRHCQRSHRRDSNNDYRFQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MTRRIQFPYRHVHCRWTARRHCQRSHRRDSNNDYRFQPSQSRQQRRLGRNRGGQTRPSIGAVTFTRRGVHSERAGEEHSETPSLSQLIRNSFLPVDLDPTENDMPETFGYEQGCHVLNDLNSRPIYNTYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.7
3 0.7
4 0.72
5 0.75
6 0.84
7 0.85
8 0.86
9 0.87
10 0.88
11 0.88
12 0.89
13 0.88
14 0.85
15 0.85
16 0.86
17 0.86
18 0.8
19 0.74
20 0.66
21 0.61
22 0.55
23 0.49
24 0.47
25 0.4
26 0.45
27 0.51
28 0.58
29 0.57
30 0.65
31 0.71
32 0.72
33 0.78
34 0.77
35 0.74
36 0.73
37 0.75
38 0.74
39 0.68
40 0.62
41 0.55
42 0.48
43 0.41
44 0.34
45 0.28
46 0.19
47 0.2
48 0.18
49 0.18
50 0.17
51 0.16
52 0.16
53 0.16
54 0.19
55 0.19
56 0.23
57 0.21
58 0.22
59 0.23
60 0.24
61 0.25
62 0.23
63 0.21
64 0.18
65 0.15
66 0.14
67 0.13
68 0.1
69 0.11
70 0.11
71 0.09
72 0.1
73 0.12
74 0.15
75 0.17
76 0.17
77 0.18
78 0.17
79 0.17
80 0.16
81 0.14
82 0.15
83 0.14
84 0.15
85 0.13
86 0.18
87 0.18
88 0.17
89 0.17
90 0.13
91 0.14
92 0.13
93 0.17
94 0.12
95 0.14
96 0.15
97 0.15
98 0.16
99 0.16
100 0.17
101 0.13
102 0.13
103 0.14
104 0.15
105 0.21
106 0.23
107 0.26
108 0.26
109 0.27
110 0.28