Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1EB82

Protein Details
Accession A0A2V1EB82    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-23VEKGTRRSRWRRSEEASWNEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, mito 8, E.R. 4, mito_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQGVEKGTRRSRWRRSEEASWNEVLSVCLSVCLCLCLTWPAFPTSFTPAAEALVRFGSGTTPNLNARYAICCAFAWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.78
3 0.8
4 0.8
5 0.76
6 0.69
7 0.59
8 0.51
9 0.43
10 0.36
11 0.26
12 0.17
13 0.11
14 0.07
15 0.07
16 0.07
17 0.07
18 0.06
19 0.07
20 0.06
21 0.05
22 0.06
23 0.08
24 0.08
25 0.09
26 0.1
27 0.11
28 0.11
29 0.12
30 0.13
31 0.15
32 0.17
33 0.16
34 0.16
35 0.15
36 0.15
37 0.16
38 0.14
39 0.1
40 0.09
41 0.09
42 0.08
43 0.08
44 0.08
45 0.09
46 0.11
47 0.11
48 0.14
49 0.17
50 0.19
51 0.2
52 0.19
53 0.19
54 0.21
55 0.21
56 0.19
57 0.19