Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1D610

Protein Details
Accession A0A2V1D610   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
79-103QEQSRLNKGRKRRRKFLLRTDTYPIHydrophilic
NLS Segment(s)
PositionSequence
85-93NKGRKRRRK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001660  SAM  
IPR013761  SAM/pointed_sf  
Pfam View protein in Pfam  
PF00536  SAM_1  
Amino Acid Sequences MMDNQLCDHLQRLGLAQYVTVLQENGYKSWTQLGTIREGDFDHLGFKLGHRRRLQRQIATMNGYPQSEALLPDEIETAQEQSRLNKGRKRRRKFLLRTDTYPINRASNKLQVSNAIKTHKPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.14
4 0.12
5 0.12
6 0.12
7 0.11
8 0.09
9 0.07
10 0.11
11 0.13
12 0.13
13 0.14
14 0.13
15 0.13
16 0.18
17 0.18
18 0.15
19 0.18
20 0.19
21 0.22
22 0.24
23 0.24
24 0.2
25 0.2
26 0.2
27 0.16
28 0.15
29 0.11
30 0.09
31 0.1
32 0.09
33 0.1
34 0.18
35 0.21
36 0.29
37 0.33
38 0.4
39 0.46
40 0.57
41 0.62
42 0.57
43 0.59
44 0.55
45 0.53
46 0.5
47 0.43
48 0.34
49 0.29
50 0.25
51 0.19
52 0.14
53 0.13
54 0.09
55 0.09
56 0.08
57 0.08
58 0.08
59 0.08
60 0.09
61 0.08
62 0.08
63 0.07
64 0.08
65 0.07
66 0.1
67 0.1
68 0.11
69 0.19
70 0.25
71 0.3
72 0.34
73 0.44
74 0.53
75 0.64
76 0.71
77 0.74
78 0.78
79 0.84
80 0.88
81 0.89
82 0.89
83 0.85
84 0.81
85 0.77
86 0.75
87 0.66
88 0.6
89 0.51
90 0.47
91 0.41
92 0.4
93 0.39
94 0.39
95 0.4
96 0.39
97 0.38
98 0.39
99 0.43
100 0.46
101 0.47
102 0.44