Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2UEU8

Protein Details
Accession Q2UEU8   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKQSRQKKRLSQKPTKWGNDCSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
Amino Acid Sequences MKQSRQKKRLSQKPTKWGNDCSVLYSSLASKILNHHTSLSYIFDSMHTQQNASYAEIREVESWGCLHIVEVESHMNNLRGVGLTQAATHYICSSAASCARKFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.83
4 0.77
5 0.72
6 0.68
7 0.58
8 0.51
9 0.43
10 0.34
11 0.29
12 0.25
13 0.2
14 0.14
15 0.15
16 0.11
17 0.1
18 0.14
19 0.21
20 0.22
21 0.22
22 0.21
23 0.21
24 0.22
25 0.22
26 0.2
27 0.13
28 0.12
29 0.11
30 0.1
31 0.12
32 0.13
33 0.17
34 0.15
35 0.15
36 0.15
37 0.18
38 0.18
39 0.16
40 0.16
41 0.11
42 0.12
43 0.13
44 0.14
45 0.11
46 0.11
47 0.1
48 0.08
49 0.08
50 0.08
51 0.07
52 0.06
53 0.05
54 0.06
55 0.07
56 0.07
57 0.08
58 0.1
59 0.1
60 0.11
61 0.12
62 0.11
63 0.1
64 0.1
65 0.1
66 0.08
67 0.08
68 0.09
69 0.09
70 0.08
71 0.08
72 0.09
73 0.1
74 0.1
75 0.1
76 0.1
77 0.09
78 0.09
79 0.1
80 0.1
81 0.13
82 0.2
83 0.24