Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1DE55

Protein Details
Accession A0A2V1DE55    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
70-102AARLIDSKSKNKRASKKKPGKKPPAKPAKPPKPBasic
NLS Segment(s)
PositionSequence
77-102KSKNKRASKKKPGKKPPAKPAKPPKP
Subcellular Location(s) extr 20, mito 2, E.R. 2, nucl 1, cyto 1, cyto_nucl 1, golg 1
Family & Domain DBs
Amino Acid Sequences MRFGAVLLAFTASIVLGTADIFQDEPAVHLKPKGLDDARRSDVTSNLENSDAVLPRGPHAVEASTDGELAARLIDSKSKNKRASKKKPGKKPPAKPAKPPKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.04
5 0.04
6 0.04
7 0.05
8 0.05
9 0.05
10 0.06
11 0.06
12 0.07
13 0.09
14 0.1
15 0.11
16 0.11
17 0.13
18 0.14
19 0.16
20 0.21
21 0.22
22 0.26
23 0.3
24 0.35
25 0.38
26 0.36
27 0.36
28 0.3
29 0.3
30 0.28
31 0.26
32 0.21
33 0.18
34 0.17
35 0.16
36 0.16
37 0.15
38 0.11
39 0.09
40 0.09
41 0.08
42 0.09
43 0.1
44 0.1
45 0.08
46 0.08
47 0.09
48 0.08
49 0.11
50 0.11
51 0.1
52 0.1
53 0.09
54 0.09
55 0.08
56 0.08
57 0.05
58 0.03
59 0.04
60 0.05
61 0.1
62 0.13
63 0.23
64 0.32
65 0.42
66 0.5
67 0.59
68 0.69
69 0.76
70 0.83
71 0.86
72 0.88
73 0.89
74 0.91
75 0.93
76 0.94
77 0.94
78 0.94
79 0.93
80 0.93
81 0.9
82 0.9