Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1D3D9

Protein Details
Accession A0A2V1D3D9    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
56-76NFPHVRRRGLVKKIKICKFYFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, mito_nucl 13.166, nucl 7, cyto_nucl 6.166
Family & Domain DBs
Amino Acid Sequences MFSKPFTSRTSSTSTAVSKTSSSYSHFSLKAALKKPFQGWSKEALWARQDLDDDYNFPHVRRRGLVKKIKICKFYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.31
3 0.3
4 0.27
5 0.21
6 0.19
7 0.2
8 0.17
9 0.19
10 0.2
11 0.21
12 0.25
13 0.25
14 0.23
15 0.26
16 0.29
17 0.33
18 0.35
19 0.36
20 0.33
21 0.35
22 0.37
23 0.39
24 0.37
25 0.34
26 0.3
27 0.31
28 0.31
29 0.33
30 0.32
31 0.28
32 0.26
33 0.23
34 0.23
35 0.19
36 0.19
37 0.15
38 0.17
39 0.15
40 0.15
41 0.15
42 0.2
43 0.2
44 0.19
45 0.25
46 0.25
47 0.28
48 0.32
49 0.4
50 0.43
51 0.53
52 0.62
53 0.65
54 0.72
55 0.78
56 0.82