Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DNE1

Protein Details
Accession A0A2V1DNE1    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
32-55EALKKREERRKARAEKLQRKEREKBasic
68-98IRQEKQLQKDQQKKEKKPQKRRREDSTTETSHydrophilic
NLS Segment(s)
PositionSequence
14-91EAEERRRNWAAEKERKAQEALKKREERRKARAEKLQRKEREKEERLVRPQVNKQIRQEKQLQKDQQKKEKKPQKRRRE
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MNELEEQKQREKAEAEERRRNWAAEKERKAQEALKKREERRKARAEKLQRKEREKEERLVRPQVNKQIRQEKQLQKDQQKKEKKPQKRRREDSTTETSKRHKSVVGRNGRQITLPLRFRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.59
4 0.59
5 0.63
6 0.63
7 0.58
8 0.53
9 0.53
10 0.54
11 0.55
12 0.6
13 0.6
14 0.62
15 0.62
16 0.59
17 0.55
18 0.54
19 0.54
20 0.55
21 0.57
22 0.61
23 0.67
24 0.74
25 0.78
26 0.77
27 0.76
28 0.8
29 0.78
30 0.78
31 0.8
32 0.81
33 0.82
34 0.83
35 0.83
36 0.8
37 0.78
38 0.76
39 0.75
40 0.74
41 0.68
42 0.66
43 0.64
44 0.64
45 0.62
46 0.63
47 0.57
48 0.51
49 0.52
50 0.54
51 0.53
52 0.5
53 0.52
54 0.55
55 0.55
56 0.54
57 0.59
58 0.58
59 0.59
60 0.63
61 0.64
62 0.64
63 0.72
64 0.76
65 0.76
66 0.78
67 0.78
68 0.8
69 0.83
70 0.84
71 0.86
72 0.88
73 0.89
74 0.9
75 0.91
76 0.9
77 0.89
78 0.85
79 0.81
80 0.8
81 0.77
82 0.7
83 0.66
84 0.62
85 0.6
86 0.55
87 0.5
88 0.45
89 0.45
90 0.51
91 0.57
92 0.62
93 0.61
94 0.67
95 0.69
96 0.64
97 0.57
98 0.51
99 0.47
100 0.45