Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1D063

Protein Details
Accession A0A2V1D063    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
34-59RLYSCIARVREKRREKKKRDINVSTFHydrophilic
NLS Segment(s)
PositionSequence
43-52REKRREKKKR
Subcellular Location(s) plas 10, extr 5, mito 4, E.R. 2, golg 2, nucl 1, cyto 1, cyto_nucl 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MFRVCVCGRFFLNFCLFFSCCEEEYACIQVVLVRLYSCIARVREKRREKKKRDINVSTFSFLLFSSLRPSSPSSLITYCLPLFPFSSVYPLKPHNFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.29
4 0.26
5 0.3
6 0.27
7 0.22
8 0.23
9 0.22
10 0.19
11 0.21
12 0.21
13 0.16
14 0.13
15 0.12
16 0.12
17 0.13
18 0.11
19 0.1
20 0.07
21 0.07
22 0.08
23 0.08
24 0.08
25 0.12
26 0.13
27 0.2
28 0.28
29 0.36
30 0.46
31 0.56
32 0.65
33 0.72
34 0.81
35 0.81
36 0.85
37 0.87
38 0.86
39 0.86
40 0.84
41 0.78
42 0.75
43 0.69
44 0.6
45 0.49
46 0.4
47 0.3
48 0.21
49 0.18
50 0.1
51 0.08
52 0.11
53 0.12
54 0.12
55 0.14
56 0.17
57 0.17
58 0.19
59 0.21
60 0.2
61 0.21
62 0.23
63 0.22
64 0.23
65 0.2
66 0.2
67 0.19
68 0.16
69 0.16
70 0.16
71 0.17
72 0.14
73 0.21
74 0.21
75 0.22
76 0.26
77 0.31