Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DJY5

Protein Details
Accession A0A2V1DJY5   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
57-83QLITPRRERLRPRPRARYEKKKQIAFVHydrophilic
NLS Segment(s)
PositionSequence
62-78RRERLRPRPRARYEKKK
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MRITHPGIIGRFHPSPKPCTRAPQTSFIPTSSSCERWRNARADLAPPPSHKHQLNTQLITPRRERLRPRPRARYEKKKQIAFVNLHSAANEEGWRASEEELEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.41
3 0.46
4 0.49
5 0.46
6 0.52
7 0.57
8 0.6
9 0.6
10 0.6
11 0.56
12 0.57
13 0.56
14 0.47
15 0.42
16 0.32
17 0.34
18 0.29
19 0.29
20 0.27
21 0.3
22 0.31
23 0.35
24 0.4
25 0.39
26 0.37
27 0.38
28 0.36
29 0.35
30 0.38
31 0.37
32 0.34
33 0.31
34 0.33
35 0.32
36 0.35
37 0.32
38 0.3
39 0.3
40 0.37
41 0.41
42 0.39
43 0.38
44 0.4
45 0.42
46 0.43
47 0.39
48 0.36
49 0.35
50 0.4
51 0.45
52 0.49
53 0.57
54 0.64
55 0.72
56 0.77
57 0.82
58 0.87
59 0.89
60 0.89
61 0.89
62 0.89
63 0.88
64 0.83
65 0.78
66 0.74
67 0.72
68 0.65
69 0.59
70 0.57
71 0.5
72 0.45
73 0.4
74 0.34
75 0.26
76 0.23
77 0.19
78 0.11
79 0.1
80 0.11
81 0.13
82 0.13
83 0.13