Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1D123

Protein Details
Accession A0A2V1D123   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-37FSTLKRTRNGCHTCKRRRKGCDEKRPVCGAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSPATLSFSTLKRTRNGCHTCKRRRKGCDEKRPVCGACAKLHLKCSYHLPLRWASTRGPFIEYRKPFSVTVSLPCDELRQVLQRIGVSSELERIVYSTLGDKEREILFKCVLHTCSIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.51
3 0.58
4 0.59
5 0.65
6 0.72
7 0.76
8 0.82
9 0.87
10 0.86
11 0.86
12 0.88
13 0.89
14 0.89
15 0.89
16 0.9
17 0.85
18 0.82
19 0.79
20 0.69
21 0.6
22 0.54
23 0.45
24 0.37
25 0.38
26 0.35
27 0.31
28 0.35
29 0.36
30 0.32
31 0.3
32 0.33
33 0.33
34 0.34
35 0.34
36 0.32
37 0.32
38 0.34
39 0.35
40 0.31
41 0.26
42 0.25
43 0.26
44 0.24
45 0.24
46 0.22
47 0.24
48 0.31
49 0.31
50 0.33
51 0.32
52 0.34
53 0.31
54 0.31
55 0.31
56 0.23
57 0.26
58 0.25
59 0.23
60 0.21
61 0.21
62 0.2
63 0.16
64 0.16
65 0.14
66 0.14
67 0.15
68 0.16
69 0.18
70 0.17
71 0.18
72 0.18
73 0.17
74 0.14
75 0.13
76 0.14
77 0.13
78 0.12
79 0.11
80 0.1
81 0.1
82 0.09
83 0.09
84 0.11
85 0.14
86 0.16
87 0.17
88 0.17
89 0.2
90 0.22
91 0.27
92 0.26
93 0.27
94 0.27
95 0.28
96 0.31
97 0.33
98 0.31