Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1D9F6

Protein Details
Accession A0A2V1D9F6    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
102-121RGMQKHCKEKHDWVNEQKRGBasic
NLS Segment(s)
Subcellular Location(s) cyto 13, mito 7, pero 4, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR022698  OrsD  
Pfam View protein in Pfam  
PF12013  OrsD  
Amino Acid Sequences MESFAQLFEHLPELRVIVCQPCATAIPPAQVVTHLKERHPNAAVATRKSLAAIAHALPDLAWIPGDVRVPKPAQKPIAGLKTQGDGLACLVEGCWYVCVSLRGMQKHCKEKHDWVNEQKRGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.12
5 0.14
6 0.13
7 0.13
8 0.13
9 0.14
10 0.14
11 0.17
12 0.16
13 0.16
14 0.17
15 0.17
16 0.16
17 0.17
18 0.19
19 0.19
20 0.25
21 0.25
22 0.25
23 0.32
24 0.34
25 0.38
26 0.37
27 0.34
28 0.28
29 0.34
30 0.37
31 0.31
32 0.32
33 0.26
34 0.24
35 0.23
36 0.22
37 0.14
38 0.12
39 0.12
40 0.09
41 0.1
42 0.09
43 0.09
44 0.07
45 0.08
46 0.07
47 0.05
48 0.04
49 0.03
50 0.04
51 0.06
52 0.08
53 0.08
54 0.09
55 0.12
56 0.14
57 0.19
58 0.23
59 0.27
60 0.28
61 0.29
62 0.31
63 0.35
64 0.4
65 0.35
66 0.33
67 0.28
68 0.27
69 0.25
70 0.23
71 0.16
72 0.1
73 0.1
74 0.08
75 0.07
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.06
84 0.08
85 0.09
86 0.11
87 0.16
88 0.22
89 0.27
90 0.31
91 0.4
92 0.47
93 0.56
94 0.59
95 0.59
96 0.61
97 0.65
98 0.71
99 0.73
100 0.74
101 0.74
102 0.8