Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DYI7

Protein Details
Accession A0A2V1DYI7   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
235-259TKTVDKKGRSIQRRYDSKRRRFMAVHydrophilic
NLS Segment(s)
PositionSequence
252-254KRR
Subcellular Location(s) nucl 7mito 7mito_nucl 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MPPSPLSLLSPNCLLWLGAYYSCRTLQSEMHAYFQPGAPKALTGGRLIFYEDPFTLSMYFRYPNDDWFTWVEFDNITPSLNAFGLISKLTAPLQVPLSDFKKTWLDYTFVRDMVNTLLGLYINHVHFTLHWDEHWVRPFEAFEGDMADGLVIPFILAQTVHCNVVTVALERPEDIWAKSKTLSPVEKVVGWGSKDVPVGEQYLEPHGNGRVGGYKKVPRSEPLEQRDLRVEYTVTKTVDKKGRSIQRRYDSKRRRFMAVKVDSVGRRMRRSVREVVSALGSFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.13
3 0.14
4 0.14
5 0.14
6 0.16
7 0.17
8 0.19
9 0.21
10 0.22
11 0.21
12 0.21
13 0.21
14 0.27
15 0.34
16 0.32
17 0.35
18 0.34
19 0.34
20 0.32
21 0.32
22 0.3
23 0.23
24 0.23
25 0.2
26 0.19
27 0.19
28 0.21
29 0.2
30 0.17
31 0.17
32 0.16
33 0.16
34 0.19
35 0.19
36 0.16
37 0.18
38 0.16
39 0.16
40 0.15
41 0.16
42 0.14
43 0.13
44 0.14
45 0.13
46 0.15
47 0.14
48 0.2
49 0.2
50 0.24
51 0.3
52 0.29
53 0.29
54 0.3
55 0.31
56 0.26
57 0.25
58 0.21
59 0.15
60 0.15
61 0.14
62 0.12
63 0.1
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.06
75 0.07
76 0.07
77 0.09
78 0.08
79 0.1
80 0.11
81 0.12
82 0.13
83 0.16
84 0.18
85 0.19
86 0.18
87 0.19
88 0.22
89 0.21
90 0.23
91 0.2
92 0.2
93 0.2
94 0.26
95 0.26
96 0.22
97 0.21
98 0.18
99 0.17
100 0.16
101 0.15
102 0.09
103 0.06
104 0.06
105 0.06
106 0.06
107 0.06
108 0.08
109 0.08
110 0.08
111 0.08
112 0.08
113 0.08
114 0.12
115 0.14
116 0.11
117 0.11
118 0.15
119 0.16
120 0.19
121 0.24
122 0.21
123 0.18
124 0.19
125 0.19
126 0.15
127 0.15
128 0.12
129 0.08
130 0.08
131 0.07
132 0.07
133 0.06
134 0.05
135 0.04
136 0.04
137 0.04
138 0.02
139 0.02
140 0.02
141 0.02
142 0.02
143 0.02
144 0.03
145 0.06
146 0.07
147 0.08
148 0.08
149 0.08
150 0.08
151 0.1
152 0.1
153 0.08
154 0.08
155 0.1
156 0.1
157 0.1
158 0.1
159 0.11
160 0.11
161 0.11
162 0.16
163 0.16
164 0.18
165 0.19
166 0.21
167 0.22
168 0.27
169 0.29
170 0.25
171 0.28
172 0.28
173 0.27
174 0.25
175 0.24
176 0.21
177 0.19
178 0.18
179 0.15
180 0.16
181 0.16
182 0.15
183 0.14
184 0.13
185 0.13
186 0.13
187 0.13
188 0.11
189 0.15
190 0.15
191 0.14
192 0.15
193 0.14
194 0.14
195 0.13
196 0.13
197 0.16
198 0.17
199 0.2
200 0.24
201 0.29
202 0.34
203 0.39
204 0.4
205 0.37
206 0.43
207 0.5
208 0.54
209 0.54
210 0.58
211 0.54
212 0.54
213 0.56
214 0.5
215 0.42
216 0.34
217 0.28
218 0.23
219 0.27
220 0.3
221 0.25
222 0.28
223 0.29
224 0.36
225 0.42
226 0.41
227 0.41
228 0.46
229 0.54
230 0.59
231 0.66
232 0.68
233 0.71
234 0.8
235 0.83
236 0.85
237 0.86
238 0.87
239 0.88
240 0.81
241 0.8
242 0.74
243 0.73
244 0.72
245 0.69
246 0.63
247 0.55
248 0.58
249 0.51
250 0.5
251 0.5
252 0.46
253 0.43
254 0.46
255 0.52
256 0.53
257 0.59
258 0.64
259 0.62
260 0.62
261 0.59
262 0.54
263 0.49