Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DKM9

Protein Details
Accession A0A2V1DKM9    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
83-124DLRPKQTRAIRRKLTKHEASLVTEKQKKKQTHFPQRKYAVKAHydrophilic
NLS Segment(s)
PositionSequence
86-98PKQTRAIRRKLTK
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSAPKVKTAQLWNKSKDDLNTQLQELKTELIALRTSKVTGSGGKLTRIHDVRKGIARVLTVINANQRAQLRLFYKGKKYAPLDLRPKQTRAIRRKLTKHEASLVTEKQKKKQTHFPQRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.6
3 0.53
4 0.5
5 0.48
6 0.46
7 0.43
8 0.41
9 0.43
10 0.39
11 0.37
12 0.3
13 0.24
14 0.17
15 0.15
16 0.14
17 0.11
18 0.13
19 0.13
20 0.13
21 0.13
22 0.14
23 0.12
24 0.13
25 0.13
26 0.13
27 0.15
28 0.2
29 0.2
30 0.24
31 0.26
32 0.26
33 0.31
34 0.32
35 0.31
36 0.29
37 0.3
38 0.3
39 0.33
40 0.32
41 0.26
42 0.25
43 0.23
44 0.2
45 0.18
46 0.15
47 0.11
48 0.11
49 0.12
50 0.12
51 0.12
52 0.14
53 0.14
54 0.14
55 0.14
56 0.18
57 0.17
58 0.23
59 0.28
60 0.28
61 0.33
62 0.39
63 0.4
64 0.42
65 0.43
66 0.44
67 0.47
68 0.52
69 0.56
70 0.56
71 0.64
72 0.61
73 0.6
74 0.59
75 0.59
76 0.6
77 0.6
78 0.64
79 0.64
80 0.7
81 0.77
82 0.8
83 0.82
84 0.79
85 0.74
86 0.71
87 0.65
88 0.61
89 0.59
90 0.54
91 0.53
92 0.54
93 0.53
94 0.54
95 0.59
96 0.61
97 0.62
98 0.68
99 0.7
100 0.75
101 0.82
102 0.83
103 0.85
104 0.87