Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1D645

Protein Details
Accession A0A2V1D645   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPSTGKPTKTGQPRGRPRKHLNASAAHydrophilic
NLS Segment(s)
PositionSequence
10-41TGQPRGRPRKHLNASAAAEAKKDSDRRRYQRS
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MPSTGKPTKTGQPRGRPRKHLNASAAAEAKKDSDRRRYQRSRGLGGPAKFIHYAPAFPGAPSNTNPDLGLRISADVSIPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.87
3 0.88
4 0.86
5 0.87
6 0.84
7 0.81
8 0.75
9 0.72
10 0.65
11 0.59
12 0.54
13 0.43
14 0.36
15 0.28
16 0.25
17 0.21
18 0.24
19 0.24
20 0.31
21 0.4
22 0.47
23 0.57
24 0.64
25 0.67
26 0.7
27 0.7
28 0.65
29 0.57
30 0.57
31 0.53
32 0.45
33 0.43
34 0.35
35 0.32
36 0.28
37 0.26
38 0.23
39 0.18
40 0.18
41 0.14
42 0.2
43 0.17
44 0.17
45 0.2
46 0.17
47 0.19
48 0.2
49 0.25
50 0.21
51 0.22
52 0.22
53 0.2
54 0.21
55 0.19
56 0.19
57 0.13
58 0.13
59 0.13
60 0.13