Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1D108

Protein Details
Accession A0A2V1D108    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
26-53PYKLISRKVTTKKYRRLFKKAVCFCVRFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences DTVYYTNVSIRCLLRSLYLDRTYKAPYKLISRKVTTKKYRRLFKKAVCFCVRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.23
4 0.26
5 0.31
6 0.3
7 0.3
8 0.32
9 0.33
10 0.34
11 0.32
12 0.27
13 0.23
14 0.31
15 0.37
16 0.43
17 0.45
18 0.44
19 0.52
20 0.58
21 0.66
22 0.68
23 0.71
24 0.73
25 0.77
26 0.83
27 0.83
28 0.85
29 0.85
30 0.84
31 0.85
32 0.83
33 0.84