Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DST0

Protein Details
Accession A0A2V1DST0    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
125-149QKHVLRRSLLPHKPRRKEARFTTLPHydrophilic
NLS Segment(s)
PositionSequence
134-144LPHKPRRKEAR
154-163KTRIRARRAK
Subcellular Location(s) nucl 9mito 9mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MGRAWAPPLTQHAAALLPAALLHFDTQSSLAYAILFGDLAEKRSEFVLQISADRQTSLSHPKDVATPPQRLTRWTSGSRNHTLEHGPAAKTIAPDGGRCARNPDFEKYPPDRPFFVCAMSTNSPQKHVLRRSLLPHKPRRKEARFTTLPPLTQKTRIRARRAKAPPSSCTQGLQKRRTTYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.12
4 0.07
5 0.07
6 0.07
7 0.06
8 0.06
9 0.06
10 0.06
11 0.06
12 0.07
13 0.08
14 0.08
15 0.09
16 0.08
17 0.08
18 0.08
19 0.07
20 0.07
21 0.06
22 0.05
23 0.04
24 0.08
25 0.08
26 0.1
27 0.11
28 0.11
29 0.11
30 0.12
31 0.13
32 0.09
33 0.1
34 0.12
35 0.12
36 0.13
37 0.14
38 0.15
39 0.15
40 0.14
41 0.14
42 0.11
43 0.14
44 0.21
45 0.22
46 0.22
47 0.22
48 0.23
49 0.26
50 0.27
51 0.33
52 0.3
53 0.31
54 0.32
55 0.39
56 0.39
57 0.37
58 0.41
59 0.37
60 0.38
61 0.4
62 0.43
63 0.43
64 0.48
65 0.51
66 0.47
67 0.41
68 0.37
69 0.33
70 0.28
71 0.25
72 0.21
73 0.16
74 0.14
75 0.15
76 0.14
77 0.13
78 0.12
79 0.11
80 0.09
81 0.09
82 0.12
83 0.17
84 0.17
85 0.17
86 0.23
87 0.23
88 0.29
89 0.32
90 0.33
91 0.32
92 0.34
93 0.41
94 0.4
95 0.47
96 0.45
97 0.45
98 0.42
99 0.39
100 0.41
101 0.35
102 0.31
103 0.24
104 0.2
105 0.23
106 0.24
107 0.26
108 0.27
109 0.27
110 0.28
111 0.31
112 0.35
113 0.37
114 0.4
115 0.43
116 0.43
117 0.47
118 0.52
119 0.59
120 0.62
121 0.64
122 0.69
123 0.72
124 0.74
125 0.8
126 0.83
127 0.81
128 0.83
129 0.81
130 0.81
131 0.77
132 0.73
133 0.73
134 0.66
135 0.61
136 0.55
137 0.52
138 0.46
139 0.49
140 0.5
141 0.49
142 0.56
143 0.61
144 0.67
145 0.7
146 0.72
147 0.74
148 0.78
149 0.79
150 0.78
151 0.76
152 0.7
153 0.69
154 0.69
155 0.6
156 0.55
157 0.55
158 0.55
159 0.58
160 0.62
161 0.62