Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1E619

Protein Details
Accession A0A2V1E619    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
20-45KVDPQEKKKTPKGRAKKRLTYTRRFVBasic
NLS Segment(s)
PositionSequence
19-37PKVDPQEKKKTPKGRAKKR
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVDPQEKKKTPKGRAKKRLTYTRRFVNVTMTGGKRKMNPNPGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.46
5 0.48
6 0.57
7 0.59
8 0.65
9 0.64
10 0.67
11 0.7
12 0.71
13 0.74
14 0.73
15 0.75
16 0.74
17 0.79
18 0.8
19 0.8
20 0.83
21 0.85
22 0.86
23 0.86
24 0.87
25 0.85
26 0.83
27 0.79
28 0.77
29 0.73
30 0.66
31 0.58
32 0.54
33 0.49
34 0.43
35 0.42
36 0.36
37 0.35
38 0.35
39 0.37
40 0.37
41 0.42
42 0.47