Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1DCZ0

Protein Details
Accession A0A2V1DCZ0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
16-38YLLHGGRRTRRPRVSKKDWDGRVBasic
NLS Segment(s)
PositionSequence
25-27RRP
Subcellular Location(s) extr 15, mito 7.5, cyto_mito 5.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MIHHAPPLLFLFLLAYLLHGGRRTRRPRVSKKDWDGRVIFGDWLWGHVRRCSLGSGVRCASRLVIGSESGSGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.07
5 0.08
6 0.1
7 0.12
8 0.18
9 0.28
10 0.34
11 0.43
12 0.52
13 0.61
14 0.7
15 0.78
16 0.81
17 0.82
18 0.84
19 0.84
20 0.77
21 0.73
22 0.63
23 0.54
24 0.45
25 0.36
26 0.27
27 0.17
28 0.16
29 0.11
30 0.12
31 0.12
32 0.14
33 0.14
34 0.16
35 0.17
36 0.16
37 0.17
38 0.17
39 0.18
40 0.21
41 0.23
42 0.27
43 0.28
44 0.28
45 0.28
46 0.27
47 0.25
48 0.21
49 0.2
50 0.17
51 0.16
52 0.16
53 0.16