Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V1ECD6

Protein Details
Accession A0A2V1ECD6    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
57-78IISVVKKKKKRGLRLTWRGIAIHydrophilic
NLS Segment(s)
PositionSequence
62-69KKKKKRGL
Subcellular Location(s) mito 13.5, mito_nucl 12.333, nucl 10, cyto_nucl 7.333
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKVQINNGQRRGKSSERNVRGDDMRHGPWIREGSRNAPMGWDTVGSYHSFKAVLEAIISVVKKKKKRGLRLTWRGIAITVCIHVESWLMGCKVTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.65
3 0.65
4 0.7
5 0.67
6 0.65
7 0.6
8 0.53
9 0.48
10 0.42
11 0.37
12 0.37
13 0.35
14 0.3
15 0.31
16 0.34
17 0.3
18 0.3
19 0.31
20 0.29
21 0.35
22 0.36
23 0.31
24 0.26
25 0.24
26 0.2
27 0.18
28 0.14
29 0.08
30 0.07
31 0.08
32 0.08
33 0.08
34 0.08
35 0.08
36 0.07
37 0.07
38 0.08
39 0.08
40 0.07
41 0.06
42 0.06
43 0.07
44 0.08
45 0.09
46 0.09
47 0.14
48 0.2
49 0.25
50 0.33
51 0.41
52 0.48
53 0.59
54 0.68
55 0.74
56 0.8
57 0.85
58 0.86
59 0.82
60 0.73
61 0.63
62 0.53
63 0.42
64 0.32
65 0.22
66 0.15
67 0.11
68 0.1
69 0.1
70 0.09
71 0.09
72 0.08
73 0.09
74 0.12
75 0.12