Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1EA99

Protein Details
Accession A0A2V1EA99   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
35-84PIPNISKMKMKKKMKKKMKKKMKKKKKMKKKMKKKMKKKMKKNAMQGVYVBasic
NLS Segment(s)
PositionSequence
40-76SKMKMKKKMKKKMKKKMKKKKKMKKKMKKKMKKKMKK
Subcellular Location(s) mito 15, nucl 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MTTGFTKYTAFDLLSELDADNRDYMKSSNKAPTPPIPNISKMKMKKKMKKKMKKKMKKKKKMKKKMKKKMKKKMKKNAMQGVYVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.12
4 0.11
5 0.11
6 0.12
7 0.11
8 0.1
9 0.1
10 0.1
11 0.11
12 0.17
13 0.19
14 0.22
15 0.28
16 0.3
17 0.32
18 0.35
19 0.41
20 0.4
21 0.4
22 0.41
23 0.36
24 0.38
25 0.39
26 0.39
27 0.4
28 0.4
29 0.46
30 0.51
31 0.59
32 0.63
33 0.71
34 0.78
35 0.81
36 0.86
37 0.89
38 0.9
39 0.92
40 0.93
41 0.94
42 0.95
43 0.95
44 0.95
45 0.96
46 0.96
47 0.96
48 0.96
49 0.96
50 0.96
51 0.96
52 0.96
53 0.96
54 0.96
55 0.96
56 0.96
57 0.95
58 0.95
59 0.95
60 0.95
61 0.95
62 0.94
63 0.93
64 0.92
65 0.86