Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1DKE2

Protein Details
Accession A0A2V1DKE2    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-79CEFVRGSRNNKKRSNRLKRLKLRQKAQQKVHydrophilic
105-126KQAARGTEKQQKQNAKRYKQTLHydrophilic
NLS Segment(s)
PositionSequence
56-117SRNNKKRSNRLKRLKLRQKAQQKVLELKEKEERKRFGVEKKERERVKAEKQAARGTEKQQKQ
Subcellular Location(s) nucl 15, cyto_nucl 13.333, mito_nucl 9.999, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MSVIGSSSGDTVPKVPYLGIVYVWLPLFEFGQVGWNTVTRDRSLKEARYCEFVRGSRNNKKRSNRLKRLKLRQKAQQKVLELKEKEERKRFGVEKKERERVKAEKQAARGTEKQQKQNAKRYKQTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.13
4 0.15
5 0.15
6 0.13
7 0.13
8 0.12
9 0.14
10 0.14
11 0.11
12 0.09
13 0.09
14 0.09
15 0.07
16 0.07
17 0.05
18 0.12
19 0.12
20 0.13
21 0.13
22 0.14
23 0.15
24 0.18
25 0.2
26 0.15
27 0.18
28 0.17
29 0.24
30 0.28
31 0.33
32 0.37
33 0.4
34 0.4
35 0.43
36 0.43
37 0.38
38 0.36
39 0.32
40 0.32
41 0.35
42 0.42
43 0.45
44 0.53
45 0.59
46 0.63
47 0.69
48 0.73
49 0.77
50 0.8
51 0.81
52 0.84
53 0.86
54 0.88
55 0.91
56 0.91
57 0.88
58 0.84
59 0.82
60 0.82
61 0.79
62 0.77
63 0.71
64 0.65
65 0.64
66 0.62
67 0.61
68 0.51
69 0.47
70 0.48
71 0.49
72 0.53
73 0.53
74 0.51
75 0.46
76 0.53
77 0.55
78 0.55
79 0.59
80 0.62
81 0.65
82 0.7
83 0.76
84 0.7
85 0.7
86 0.68
87 0.66
88 0.66
89 0.65
90 0.65
91 0.61
92 0.63
93 0.65
94 0.62
95 0.6
96 0.55
97 0.54
98 0.55
99 0.58
100 0.61
101 0.63
102 0.7
103 0.72
104 0.78
105 0.8
106 0.8