Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1D1A4

Protein Details
Accession A0A2V1D1A4   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-34NRKLCVICKEPRSRRSKNRHPLVCSRCRTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MFCLFNRKLCVICKEPRSRRSKNRHPLVCSRCRTASRKSRKHVTVEIHHYHHDDISPQLVPGHDKDWGYSKHFELPESNITTPGTPYAYCLPEPTPYYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.66
3 0.72
4 0.75
5 0.78
6 0.82
7 0.85
8 0.87
9 0.86
10 0.88
11 0.86
12 0.84
13 0.84
14 0.83
15 0.81
16 0.74
17 0.68
18 0.63
19 0.61
20 0.59
21 0.58
22 0.59
23 0.61
24 0.66
25 0.68
26 0.72
27 0.7
28 0.71
29 0.68
30 0.65
31 0.61
32 0.6
33 0.57
34 0.49
35 0.46
36 0.41
37 0.35
38 0.28
39 0.21
40 0.14
41 0.1
42 0.1
43 0.09
44 0.08
45 0.08
46 0.08
47 0.1
48 0.1
49 0.11
50 0.12
51 0.12
52 0.13
53 0.18
54 0.21
55 0.24
56 0.25
57 0.26
58 0.3
59 0.31
60 0.31
61 0.27
62 0.29
63 0.32
64 0.34
65 0.32
66 0.27
67 0.27
68 0.26
69 0.24
70 0.22
71 0.17
72 0.12
73 0.15
74 0.19
75 0.21
76 0.21
77 0.23
78 0.22
79 0.26