Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V1D133

Protein Details
Accession A0A2V1D133    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20IKIECQRKRPWQQTDVSRRGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences IKIECQRKRPWQQTDVSRRGLPCAAAFACTDYKVQSRTLGRVALELRGTRTMNIDGQSVPSPCDPYSLYVQLSRCRSLDGIMLLSKVRERDM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.79
3 0.73
4 0.66
5 0.58
6 0.53
7 0.46
8 0.36
9 0.26
10 0.24
11 0.19
12 0.17
13 0.17
14 0.16
15 0.16
16 0.16
17 0.16
18 0.13
19 0.15
20 0.15
21 0.16
22 0.19
23 0.2
24 0.21
25 0.23
26 0.23
27 0.2
28 0.22
29 0.21
30 0.17
31 0.17
32 0.15
33 0.14
34 0.15
35 0.15
36 0.13
37 0.14
38 0.14
39 0.14
40 0.15
41 0.15
42 0.12
43 0.14
44 0.16
45 0.14
46 0.14
47 0.13
48 0.15
49 0.14
50 0.16
51 0.14
52 0.15
53 0.2
54 0.21
55 0.22
56 0.23
57 0.26
58 0.3
59 0.33
60 0.33
61 0.28
62 0.28
63 0.27
64 0.24
65 0.26
66 0.21
67 0.21
68 0.19
69 0.2
70 0.18
71 0.19
72 0.2